Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-related protein Rab-4B

Gene

RAB4B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Protein transport. Probably involved in vesicular traffic (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi15 – 23GTPCombined sources9
Nucleotide bindingi63 – 67GTPBy similarity5
Nucleotide bindingi121 – 124GTPCombined sources4
Nucleotide bindingi151 – 153GTPCombined sources3

GO - Molecular functioni

GO - Biological processi

  • glucose import Source: UniProtKB
  • neutrophil degranulation Source: Reactome
  • protein transport Source: UniProtKB-KW
  • regulation of endocytosis Source: GO_Central

Keywordsi

Biological processProtein transport, Transport
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-6798695 Neutrophil degranulation
R-HSA-8873719 RAB geranylgeranylation
R-HSA-8875656 MET receptor recycling

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-related protein Rab-4B
Gene namesi
Name:RAB4B
ORF Names:PP1596
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000167578.17
HGNCiHGNC:9782 RAB4B
MIMi612945 gene
neXtProtiNX_P61018

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi53916
OpenTargetsiENSG00000167578
PharmGKBiPA34142

Polymorphism and mutation databases

BioMutaiRAB4B
DMDMi46577635

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001210992 – 213Ras-related protein Rab-4BAdd BLAST212

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei185PhosphoserineBy similarity1
Modified residuei193PhosphoserineCombined sources1
Lipidationi211S-geranylgeranyl cysteineBy similarity1
Modified residuei213Cysteine methyl esterBy similarity1
Lipidationi213S-geranylgeranyl cysteineBy similarity1

Keywords - PTMi

Acetylation, Lipoprotein, Methylation, Phosphoprotein, Prenylation

Proteomic databases

EPDiP61018
MaxQBiP61018
PaxDbiP61018
PeptideAtlasiP61018
PRIDEiP61018
ProteomicsDBi57249
57250 [P61018-2]

PTM databases

iPTMnetiP61018
PhosphoSitePlusiP61018
SwissPalmiP61018

Expressioni

Gene expression databases

BgeeiENSG00000167578 Expressed in 198 organ(s), highest expression level in C1 segment of cervical spinal cord
CleanExiHS_RAB4B
ExpressionAtlasiP61018 baseline and differential
GenevisibleiP61018 HS

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
EXOC5O004715EBI-10218066,EBI-949824

Protein-protein interaction databases

BioGridi119816, 20 interactors
IntActiP61018, 21 interactors
STRINGi9606.ENSP00000469872

Structurei

Secondary structure

1213
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP61018
SMRiP61018
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP61018

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi37 – 45Effector regionBy similarity9

Sequence similaritiesi

Belongs to the small GTPase superfamily. Rab family.Curated

Phylogenomic databases

eggNOGiKOG0086 Eukaryota
ENOG410XQ9X LUCA
GeneTreeiENSGT00760000118841
HOGENOMiHOG000233968
HOVERGENiHBG009351
InParanoidiP61018
KOiK07880
OMAiASQNICI
OrthoDBiEOG091G0QOB
PhylomeDBiP61018
TreeFamiTF300032

Family and domain databases

InterProiView protein in InterPro
IPR027417 P-loop_NTPase
IPR005225 Small_GTP-bd_dom
IPR001806 Small_GTPase
PfamiView protein in Pfam
PF00071 Ras, 1 hit
SUPFAMiSSF52540 SSF52540, 1 hit
TIGRFAMsiTIGR00231 small_GTP, 1 hit
PROSITEiView protein in PROSITE
PS51419 RAB, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: P61018-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAETYDFLFK FLVIGSAGTG KSCLLHQFIE NKFKQDSNHT IGVEFGSRVV
60 70 80 90 100
NVGGKTVKLQ IWDTAGQERF RSVTRSYYRG AAGALLVYDI TSRETYNSLA
110 120 130 140 150
AWLTDARTLA SPNIVVILCG NKKDLDPERE VTFLEASRFA QENELMFLET
160 170 180 190 200
SALTGENVEE AFLKCARTIL NKIDSGELDP ERMGSGIQYG DASLRQLRQP
210
RSAQAVAPQP CGC
Length:213
Mass (Da):23,587
Last modified:April 26, 2004 - v1
Checksum:i0C3D76DC3285DB98
GO
Isoform 2 (identifier: P61018-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MAETY → MSVSLPLTVMVRERDWIGIHLFSLYLSLPVGIPDFGSIWS

Note: No experimental confirmation available.
Show »
Length:248
Mass (Da):27,506
Checksum:i69EBDC77A684EAC6
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q6PIK3Q6PIK3_HUMAN
HCG1995540, isoform CRA_b
RAB4B hCG_1995540, hCG_2044074
121Annotation score:
W4VSR3W4VSR3_HUMAN
HCG2044074, isoform CRA_c
MIA-RAB4B hCG_2044074
131Annotation score:
M0R0X1M0R0X1_HUMAN
Ras-related protein Rab-4B
RAB4B
192Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti4 – 6TYD → DRH in AAP97171 (Ref. 1) Curated3

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0135671 – 5MAETY → MSVSLPLTVMVRERDWIGIH LFSLYLSLPVGIPDFGSIWS in isoform 2. 1 Publication5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087861 mRNA Translation: AAP97171.1
AF165522 mRNA Translation: AAD45923.1
AF217985 mRNA Translation: AAG17228.1
AF498935 mRNA Translation: AAM21083.1
BC046927 mRNA Translation: AAH46927.1
CCDSiCCDS33030.1 [P61018-1]
RefSeqiNP_057238.3, NM_016154.4 [P61018-1]
UniGeneiHs.631539
Hs.730737

Genome annotation databases

EnsembliENST00000357052; ENSP00000349560; ENSG00000167578 [P61018-1]
ENST00000594800; ENSP00000470246; ENSG00000167578 [P61018-1]
GeneIDi53916
KEGGihsa:53916
UCSCiuc002opd.2 human [P61018-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRAB4B_HUMAN
AccessioniPrimary (citable) accession number: P61018
Secondary accession number(s): P22750, Q7Z514, Q9HBR6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: April 26, 2004
Last modified: September 12, 2018
This is version 139 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again