UniProtKB - P60981 (DEST_HUMAN)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|P60981|DEST_HUMAN Destrin OS=Homo sapiens OX=9606 GN=DSTN PE=1 SV=3 MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKKAVIFCLSADKKCIIVEEGKEILVGDV GVTITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPELAPLKSKMIYASS KDAIKKKFQGIKHECQANGPEDLNRACIAEKLGGSLIVAFEGCPV
- Align
Destrin
DSTN
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.9"Determining the differences in actin binding by human ADF and cofilin."
Yeoh S., Pope B., Mannherz H.G., Weeds A.
J. Mol. Biol. 315:911-925(2002) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION.
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- actin filament binding Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- actin filament depolymerization Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
- actin filament fragmentation Source: Ensembl
- actin filament severing Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- actin polymerization or depolymerization Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- positive regulation of actin filament depolymerization Source: Ensembl
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Molecular function | Actin-binding |
Enzyme and pathway databases
SIGNOR Signaling Network Open Resource More...SIGNORi | P60981 |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: DestrinAlternative name(s): Actin-depolymerizing factor Short name: ADF |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:DSTN Synonyms:ACTDP, DSN |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000125868.15 |
Human Gene Nomenclature Database More...HGNCi | HGNC:15750 DSTN |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 609114 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P60981 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Cytoskeleton
- actin cytoskeleton Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- cortical actin cytoskeleton Source: Ensembl
Extracellular region or secreted
- extracellular exosome Source: UniProtKBInferred from high throughput direct assayi
<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
Organism-specific databases
DisGeNET More...DisGeNETi | 11034 |
Open Targets More...OpenTargetsi | ENSG00000125868 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA27509 |
Chemistry databases
Drug and drug target database More...DrugBanki | DB04147 Lauryl Dimethylamine-N-Oxide |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | DSTN |
Domain mapping of disease mutations (DMDM) More...DMDMi | 46577586 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methioninei | RemovedCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| |||
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000214918 | 2 – 165 | DestrinAdd BLAST | 164 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 2 | N-acetylalanineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 3 | PhosphoserineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 | |
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 19 | N6-acetyllysineCombined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei
| 1 |
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi
<p>Manually curated information which has been inferred by a curator based on his/her scientific knowledge or on the scientific content of an article.</p> <p><a href="/manual/evidences#ECO:0000305">More...</a></p> Manual assertion inferred by curator fromi
- Ref.11"HERC5 is an IFN-induced HECT-type E3 protein ligase that mediates type I IFN-induced ISGylation of protein targets."
Wong J.J., Pung Y.F., Sze N.S., Chin K.C.
Proc. Natl. Acad. Sci. U.S.A. 103:10735-10740(2006) [PubMed] [Europe PMC] [Abstract]Cited for: ISGYLATION.
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
Acetylation, Phosphoprotein, Ubl conjugationProteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P60981 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P60981 |
PeptideAtlas More...PeptideAtlasi | P60981 |
PRoteomics IDEntifications database More...PRIDEi | P60981 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 57240 57241 [P60981-2] |
2D gel databases
USC-OGP 2-DE database More...OGPi | P18282 |
REPRODUCTION-2DPAGE More...REPRODUCTION-2DPAGEi | IPI00473014 |
University College Dublin 2-DE Proteome Database More...UCD-2DPAGEi | P60981 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P60981 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P60981 |
SwissPalm database of S-palmitoylation events More...SwissPalmi | P60981 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000125868 |
CleanEx database of gene expression profiles More...CleanExi | HS_DSTN |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P60981 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P60981 HS |
Organism-specific databases
Human Protein Atlas More...HPAi | CAB037094 |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi
| With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ACTB | P60709 | 6 | EBI-745191,EBI-353944 | |
| ACTG1 | P63261 | 7 | EBI-745191,EBI-351292 | |
| CFL2 | Q549N0 | 3 | EBI-745191,EBI-10201319 | |
| PS1TP5BP1 | Q1KLZ0 | 3 | EBI-745191,EBI-9978131 | |
| TAX1BP1 | Q86VP1 | 5 | EBI-745191,EBI-529518 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- actin filament binding Source: UniProtKB <p>Inferred from Direct Assay</p> <p>Used to indicate a direct assay for the function, process or component indicated by the GO term.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#ida">GO evidence code guide</a></p> Inferred from direct assayi
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 116223, 96 interactors |
Protein interaction database and analysis system More...IntActi | P60981, 22 interactors |
Molecular INTeraction database More...MINTi | P60981 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000246069 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P60981 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P60981 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Domains and Repeats
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini | 4 – 153 | ADF-HPROSITE-ProRule annotation <p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi Add BLAST | 150 |
Motif
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi | 30 – 34 | Nuclear localization signalSequence analysis | 5 |
<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG1735 Eukaryota ENOG41122P5 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00440000033289 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000039697 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG000381 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P60981 |
KEGG Orthology (KO) More...KOi | K10363 |
Identification of Orthologs from Complete Genome Data More...OMAi | QMLPEKD |
Database of Orthologous Groups More...OrthoDBi | EOG091G0PWC |
Database for complete collections of gene phylogenies More...PhylomeDBi | P60981 |
TreeFam database of animal gene trees More...TreeFami | TF328601 |
Family and domain databases
Conserved Domains Database More...CDDi | cd11286 ADF_cofilin_like, 1 hit |
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 3.40.20.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR002108 ADF-H IPR029006 ADF-H/Gelsolin-like_dom_sf IPR017904 ADF/Cofilin IPR029924 Dstn |
The PANTHER Classification System More...PANTHERi | PTHR11913 PTHR11913, 1 hit PTHR11913:SF18 PTHR11913:SF18, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00241 Cofilin_ADF, 1 hit |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR00006 COFILIN |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00102 ADF, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS51263 ADF_H, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.
This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basketAdded to basket
This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
10 20 30 40 50
MASGVQVADE VCRIFYDMKV RKCSTPEEIK KRKKAVIFCL SADKKCIIVE
60 70 80 90 100
EGKEILVGDV GVTITDPFKH FVGMLPEKDC RYALYDASFE TKESRKEELM
110 120 130 140 150
FFLWAPELAP LKSKMIYASS KDAIKKKFQG IKHECQANGP EDLNRACIAE
160
KLGGSLIVAF EGCPV
The sequence of this isoform differs from the canonical sequence as follows:
1-17: Missing.
10 20 30 40 50
MKVRKCSTPE EIKKRKKAVI FCLSADKKCI IVEEGKEILV GDVGVTITDP
60 70 80 90 100
FKHFVGMLPE KDCRYALYDA SFETKESRKE ELMFFLWAPE LAPLKSKMIY
110 120 130 140
ASSKDAIKKK FQGIKHECQA NGPEDLNRAC IAEKLGGSLI VAFEGCPV
Natural variant
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036459 | 139 | G → E in a colorectal cancer sample; somatic mutation. 1 Publication <p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
| 1 |
Alternative sequence
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | S65738 mRNA Translation: AAB28361.1 CR457042 mRNA Translation: CAG33323.1 AK302338 mRNA Translation: BAG63668.1 AK312645 mRNA Translation: BAG35529.1 AL132765 Genomic DNA No translation available. CH471133 Genomic DNA Translation: EAX10274.1 CH471133 Genomic DNA Translation: EAX10275.1 CH471133 Genomic DNA Translation: EAX10276.1 BC009477 mRNA Translation: AAH09477.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS13127.1 [P60981-1] CCDS46580.1 [P60981-2] |
Protein sequence database of the Protein Information Resource More...PIRi | A54184 |
NCBI Reference Sequences More...RefSeqi | NP_001011546.1, NM_001011546.1 [P60981-2] NP_006861.1, NM_006870.3 [P60981-1] XP_011527444.1, XM_011529142.1 [P60981-1] XP_011527445.1, XM_011529143.1 [P60981-1] XP_011527446.1, XM_011529144.1 [P60981-2] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.304192 Hs.705996 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000246069; ENSP00000246069; ENSG00000125868 [P60981-1] ENST00000474024; ENSP00000476975; ENSG00000125868 [P60981-2] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 11034 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:11034 |
UCSC genome browser More...UCSCi | uc002wpq.4 human [P60981-1] |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi
Alternative splicing, Polymorphism<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P60981 | Destrin | 165 | |||
| Destrin | ) | 165 | |||
| Epididymis luminal protein 32 | 165 | ||||
| Destrin isoform a | 165 | ||||
| DSTN isoform 1 | 165 | ||||
| +21 | |||||
| P60981-2 | Destrin, actin depolymerizing factor | 164 | |||
| Uncharacterized protein | 164 | ||||
| Actin-depolymerizing factor (Fragment) | 164 | ||||
| Destrin (Fragment) | 164 | ||||
| Destrin (Fragment) | 164 | ||||
| +15 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P60981 | Destrin | 165 | |||
| Destrin | ) | 165 | |||
| Epididymis luminal protein 32 | 165 | ||||
| Destrin isoform a | 165 | ||||
| DSTN isoform 1 | 165 | ||||
| +76 | |||||
| P60981-2 | Destrin, actin depolymerizing factor | 177 | |||
| UPI00020AC85B | 185 | ||||
| UPI0004E00606 | 182 | ||||
| Destrin, actin depolymerizing factor | 179 | ||||
| DSTN isoform 4 | 177 | ||||
| +62 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P60981 | Destrin | 165 | |||
| Destrin | ) | 165 | |||
| Epididymis luminal protein 32 | 165 | ||||
| Destrin isoform a | 165 | ||||
| DSTN isoform 1 | 165 | ||||
| +154 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | S65738 mRNA Translation: AAB28361.1 CR457042 mRNA Translation: CAG33323.1 AK302338 mRNA Translation: BAG63668.1 AK312645 mRNA Translation: BAG35529.1 AL132765 Genomic DNA No translation available. CH471133 Genomic DNA Translation: EAX10274.1 CH471133 Genomic DNA Translation: EAX10275.1 CH471133 Genomic DNA Translation: EAX10276.1 BC009477 mRNA Translation: AAH09477.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS13127.1 [P60981-1] CCDS46580.1 [P60981-2] |
Protein sequence database of the Protein Information Resource More...PIRi | A54184 |
NCBI Reference Sequences More...RefSeqi | NP_001011546.1, NM_001011546.1 [P60981-2] NP_006861.1, NM_006870.3 [P60981-1] XP_011527444.1, XM_011529142.1 [P60981-1] XP_011527445.1, XM_011529143.1 [P60981-1] XP_011527446.1, XM_011529144.1 [P60981-2] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.304192 Hs.705996 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P60981 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P60981 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 116223, 96 interactors |
Protein interaction database and analysis system More...IntActi | P60981, 22 interactors |
Molecular INTeraction database More...MINTi | P60981 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000246069 |
Chemistry databases
Drug and drug target database More...DrugBanki | DB04147 Lauryl Dimethylamine-N-Oxide |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P60981 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P60981 |
SwissPalm database of S-palmitoylation events More...SwissPalmi | P60981 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | DSTN |
Domain mapping of disease mutations (DMDM) More...DMDMi | 46577586 |
2D gel databases
USC-OGP 2-DE database More...OGPi | P18282 |
REPRODUCTION-2DPAGE More...REPRODUCTION-2DPAGEi | IPI00473014 |
University College Dublin 2-DE Proteome Database More...UCD-2DPAGEi | P60981 |
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P60981 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P60981 |
PeptideAtlas More...PeptideAtlasi | P60981 |
PRoteomics IDEntifications database More...PRIDEi | P60981 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 57240 57241 [P60981-2] |
Protocols and materials databases
The DNASU plasmid repository More...DNASUi | 11034 |
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000246069; ENSP00000246069; ENSG00000125868 [P60981-1] ENST00000474024; ENSP00000476975; ENSG00000125868 [P60981-2] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 11034 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:11034 |
UCSC genome browser More...UCSCi | uc002wpq.4 human [P60981-1] |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 11034 |
DisGeNET More...DisGeNETi | 11034 |
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000125868.15 |
GeneCards: human genes, protein and diseases More...GeneCardsi | DSTN |
Human Gene Nomenclature Database More...HGNCi | HGNC:15750 DSTN |
Human Protein Atlas More...HPAi | CAB037094 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 609114 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P60981 |
Open Targets More...OpenTargetsi | ENSG00000125868 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA27509 |
GenAtlas: human gene database More...GenAtlasi | Search... |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG1735 Eukaryota ENOG41122P5 LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00440000033289 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000039697 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG000381 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P60981 |
KEGG Orthology (KO) More...KOi | K10363 |
Identification of Orthologs from Complete Genome Data More...OMAi | QMLPEKD |
Database of Orthologous Groups More...OrthoDBi | EOG091G0PWC |
Database for complete collections of gene phylogenies More...PhylomeDBi | P60981 |
TreeFam database of animal gene trees More...TreeFami | TF328601 |
Enzyme and pathway databases
SIGNOR Signaling Network Open Resource More...SIGNORi | P60981 |
Miscellaneous databases
ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data More...ChiTaRSi | DSTN human |
Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens More...GenomeRNAii | 11034 |
Protein Ontology More...PROi | PR:P60981 |
The Stanford Online Universal Resource for Clones and ESTs More...SOURCEi | Search... |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000125868 |
CleanEx database of gene expression profiles More...CleanExi | HS_DSTN |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P60981 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P60981 HS |
Family and domain databases
Conserved Domains Database More...CDDi | cd11286 ADF_cofilin_like, 1 hit |
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 3.40.20.10, 1 hit |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR002108 ADF-H IPR029006 ADF-H/Gelsolin-like_dom_sf IPR017904 ADF/Cofilin IPR029924 Dstn |
The PANTHER Classification System More...PANTHERi | PTHR11913 PTHR11913, 1 hit PTHR11913:SF18 PTHR11913:SF18, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00241 Cofilin_ADF, 1 hit |
Protein Motif fingerprint database; a protein domain database More...PRINTSi | PR00006 COFILIN |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00102 ADF, 1 hit |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS51263 ADF_H, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | DEST_HUMAN | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | P60981Primary (citable) accession number: P60981 Secondary accession number(s): B2R6N2 , B4DYA6, P18282, Q5W166, Q6IAW2 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | April 26, 2004 |
| Last sequence update: | January 23, 2007 | |
| Last modified: | July 18, 2018 | |
| This is version 145 of the entry and version 3 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
Complete proteome, Direct protein sequencing, Reference proteomeDocuments
- Human chromosome 20
Human chromosome 20: entries, gene names and cross-references to MIM - Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations - Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - SIMILARITY comments
Index of protein domains and families
