Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nucleolar protein 4

Gene

Nol4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Nucleolar protein 4
Gene namesi
Name:Nol4
Synonyms:Gm1262
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 18

Organism-specific databases

MGIiMGI:2441684 Nol4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000969361 – 483Nucleolar protein 4Add BLAST483

Proteomic databases

EPDiP60954
MaxQBiP60954
PaxDbiP60954
PRIDEiP60954

PTM databases

iPTMnetiP60954
PhosphoSitePlusiP60954

Expressioni

Gene expression databases

BgeeiENSMUSG00000041923 Expressed in 131 organ(s), highest expression level in visual cortex
CleanExiMM_NOL4
ExpressionAtlasiP60954 baseline and differential
GenevisibleiP60954 MM

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IHZD Eukaryota
ENOG410YIBB LUCA
GeneTreeiENSGT00390000017363
HOGENOMiHOG000220856
HOVERGENiHBG031438
InParanoidiP60954
OMAiNETVGHS
PhylomeDBiP60954
TreeFamiTF325594

Family and domain databases

InterProiView protein in InterPro
IPR026747 NOL4
IPR039788 NOL4/NOL4L
PANTHERiPTHR12449 PTHR12449, 2 hits
PTHR12449:SF17 PTHR12449:SF17, 2 hits

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P60954-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MESERDMYRQ FQDWCLRTYG DSGKTKTVTR KKYERIVQLL NGSESSSTDN
60 70 80 90 100
AKFKFWVKSK GFQLGQPDEV RGGGGGAKQV LFVRVKTTDG VGVDEKLSLR
110 120 130 140 150
RVAVVEDFFD IIYSMHVETG PNGEQIRKHA GQKRTYKAIS ESYAFLPREA
160 170 180 190 200
VTRFLMSCSE CQKRMHLNPD GTDHKDNGKP PTLVTSMIDY NMPITMAYMK
210 220 230 240 250
HMKLQLLNSQ QDEDESSIES DEFDMSDSTR MSAVNSDLSS NLEERMQSPQ
260 270 280 290 300
TVHGQQDDDS AAESSNGNET LGHSSAASGG AHGREPEDSS SDGKTGLEQE
310 320 330 340 350
EQPLNLSDSP SSAQLTSEFR IDDQGSDGKN KYKNLLISDL KMEREARENG
360 370 380 390 400
SKSPAHSYSS YDSGKNESVD RGAEDLSLNR GDEDEDEHDE HEDSEKVNET
410 420 430 440 450
DGVEAERLKA FNSRPIPSHL TSAVAESILA SACESESRNA AKRMRLDKAQ
460 470 480
DEAAPADKQC KPEAAQATYS TATVPGSQED PQI
Length:483
Mass (Da):53,479
Last modified:April 5, 2011 - v2
Checksum:iD322BC97D1BEF741
GO
Isoform 2 (identifier: P60954-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-88: MESERDMYRQ...QVLFVRVKTT → MHERLFQAPSGGLSQ
     412-412: N → NMFVRLFVDENLDRMVPISKQPKEKIQAIIDSCRRQFPEYQERARKRIRTYLKSCRRMKRSGFEM
     480-483: DPQI → VLYINGNGTY...ELENLILQQN

Show »
Length:564
Mass (Da):62,527
Checksum:i285750F163DDDFBE
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q947E9Q947_MOUSE
Nucleolar protein 4
Nol4
637Annotation score:
G3UW35G3UW35_MOUSE
Nucleolar protein 4
Nol4 mCG_113049
573Annotation score:
E9Q5X0E9Q5X0_MOUSE
Nucleolar protein 4
Nol4
108Annotation score:
F7BIN0F7BIN0_MOUSE
Nucleolar protein 4
Nol4
419Annotation score:
F6XSA1F6XSA1_MOUSE
Nucleolar protein 4
Nol4
355Annotation score:

Sequence cautioni

The sequence AAH56377 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0407781 – 88MESER…RVKTT → MHERLFQAPSGGLSQ in isoform 2. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_040779412N → NMFVRLFVDENLDRMVPISK QPKEKIQAIIDSCRRQFPEY QERARKRIRTYLKSCRRMKR SGFEM in isoform 2. 1 Publication1
Alternative sequenceiVSP_040780480 – 483DPQI → VLYINGNGTYSYHSYRGLGG LLSLDDTSSSGPTDLSMKRQ LATGSGSSSSSTSRPQLSPT EINAVRQLVAGYRESAAFLL RSADELENLILQQN in isoform 2. 1 Publication4

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK031008 mRNA No translation available.
BC056377 mRNA Translation: AAH56377.1 Different initiation.
CCDSiCCDS29093.2 [P60954-1]
CCDS50235.1 [P60954-2]
RefSeqiNP_001154955.1, NM_001161483.1 [P60954-2]
NP_950189.2, NM_199024.2 [P60954-1]
XP_006526062.1, XM_006525999.2
UniGeneiMm.209896

Genome annotation databases

EnsembliENSMUST00000081423; ENSMUSP00000080150; ENSMUSG00000041923 [P60954-2]
ENSMUST00000097651; ENSMUSP00000095256; ENSMUSG00000041923 [P60954-1]
GeneIDi319211
KEGGimmu:319211
UCSCiuc008efq.2 mouse [P60954-2]
uc008efr.2 mouse [P60954-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK031008 mRNA No translation available.
BC056377 mRNA Translation: AAH56377.1 Different initiation.
CCDSiCCDS29093.2 [P60954-1]
CCDS50235.1 [P60954-2]
RefSeqiNP_001154955.1, NM_001161483.1 [P60954-2]
NP_950189.2, NM_199024.2 [P60954-1]
XP_006526062.1, XM_006525999.2
UniGeneiMm.209896

3D structure databases

ModBaseiSearch...
MobiDBiSearch...

PTM databases

iPTMnetiP60954
PhosphoSitePlusiP60954

Proteomic databases

EPDiP60954
MaxQBiP60954
PaxDbiP60954
PRIDEiP60954

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000081423; ENSMUSP00000080150; ENSMUSG00000041923 [P60954-2]
ENSMUST00000097651; ENSMUSP00000095256; ENSMUSG00000041923 [P60954-1]
GeneIDi319211
KEGGimmu:319211
UCSCiuc008efq.2 mouse [P60954-2]
uc008efr.2 mouse [P60954-1]

Organism-specific databases

CTDi8715
MGIiMGI:2441684 Nol4

Phylogenomic databases

eggNOGiENOG410IHZD Eukaryota
ENOG410YIBB LUCA
GeneTreeiENSGT00390000017363
HOGENOMiHOG000220856
HOVERGENiHBG031438
InParanoidiP60954
OMAiNETVGHS
PhylomeDBiP60954
TreeFamiTF325594

Miscellaneous databases

ChiTaRSiNol4 mouse
PROiPR:P60954
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000041923 Expressed in 131 organ(s), highest expression level in visual cortex
CleanExiMM_NOL4
ExpressionAtlasiP60954 baseline and differential
GenevisibleiP60954 MM

Family and domain databases

InterProiView protein in InterPro
IPR026747 NOL4
IPR039788 NOL4/NOL4L
PANTHERiPTHR12449 PTHR12449, 2 hits
PTHR12449:SF17 PTHR12449:SF17, 2 hits
ProtoNetiSearch...

Entry informationi

Entry nameiNOL4_MOUSE
AccessioniPrimary (citable) accession number: P60954
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 26, 2004
Last sequence update: April 5, 2011
Last modified: November 7, 2018
This is version 94 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again