Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Synaptosomal-associated protein 25

Gene

SNAP25

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

t-SNARE involved in the molecular regulation of neurotransmitter release. May play an important role in the synaptic function of specific neuronal systems. Associates with proteins involved in vesicle docking and membrane fusion. Regulates plasma membrane recycling through its interaction with CENPF. Modulates the gating characteristics of the delayed rectifier voltage-dependent potassium channel KCNB1 in pancreatic beta cells.By similarity

Miscellaneous

When cloned and expressed in E.coli, where protein palmitoylation does not occur, Cys-85, Cys-88, Cys-90 and Cys-92 in the protein sequence readily form an iron-sulfur cluster.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei180 – 181(Microbial infection) Cleavage; by C.botulinum neurotoxin type E (BoNT/E)1 Publication2
Sitei197 – 198(Microbial infection) Cleavage; by C.botulinum neurotoxin type A (BoNT/A, botA)1 Publication1 Publication2
Sitei198 – 199(Microbial infection) Cleavage; by C.botulinum neurotoxin type C (BoNT/C)1 Publication1 Publication2

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium-dependent protein binding Source: ParkinsonsUK-UCL
  • SNAP receptor activity Source: GO_Central
  • syntaxin-1 binding Source: UniProtKB
  • syntaxin binding Source: GO_Central
  • voltage-gated potassium channel activity Source: InterPro

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-181429 Serotonin Neurotransmitter Release Cycle
R-HSA-181430 Norepinephrine Neurotransmitter Release Cycle
R-HSA-210500 Glutamate Neurotransmitter Release Cycle
R-HSA-212676 Dopamine Neurotransmitter Release Cycle
R-HSA-264642 Acetylcholine Neurotransmitter Release Cycle
R-HSA-422356 Regulation of insulin secretion
R-HSA-449836 Other interleukin signaling
R-HSA-5250968 Toxicity of botulinum toxin type A (BoNT/A)
R-HSA-5250971 Toxicity of botulinum toxin type C (BoNT/C)
R-HSA-5250992 Toxicity of botulinum toxin type E (BoNT/E)
R-HSA-6798695 Neutrophil degranulation
R-HSA-888590 GABA synthesis, release, reuptake and degradation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P60880

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.F.1.1.1 the synaptosomal vesicle fusion pore (svf-pore) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Synaptosomal-associated protein 25
Short name:
SNAP-25
Alternative name(s):
Super protein
Short name:
SUP
Synaptosomal-associated 25 kDa protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SNAP25
Synonyms:SNAP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000132639.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:11132 SNAP25

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600322 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P60880

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Synapse, Synaptosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Myasthenic syndrome, congenital, 18 (CMS18)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of congenital myasthenic syndrome, a group of disorders characterized by failure of neuromuscular transmission, including pre-synaptic, synaptic, and post-synaptic disorders that are not of autoimmune origin. Clinical features are easy fatigability and muscle weakness affecting the axial and limb muscles (with hypotonia in early-onset forms), the ocular muscles (leading to ptosis and ophthalmoplegia), and the facial and bulbar musculature (affecting sucking and swallowing, and leading to dysphonia). The symptoms fluctuate and worsen with physical effort. CMS18 is an autosomal dominant presynaptic disorder clinically characterized by early-onset muscle weakness and easy fatigability associated with delayed psychomotor development and ataxia.
See also OMIM:616330
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07369867I → N in CMS18; interfers with calcium-induced fusion; inhibits exocytosis of catecholamine-containing vesicles. 1 Publication1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi112V → A: Mildly decreased binding affinity for ZDHHC17. 1 Publication1
Mutagenesisi113V → A: Mildly decreased binding affinity for ZDHHC17. 1 Publication1
Mutagenesisi115S → A: No effect on ZDHHC17 binding. 1 Publication1
Mutagenesisi116Q → A: Decreased binding affinity for ZDHHC17. 1 Publication1
Mutagenesisi117P → A: Decreased binding affinity for ZDHHC17. 1 Publication1
Mutagenesisi119R → A: No effect on ZDHHC17 binding. 1 Publication1
Mutagenesisi152Q → A: Decreased cleavage by C.botulinum BoNT/C, no change in cleavage by C.botulinum BoNT/A (botA). 1 Publication1
Mutagenesisi156I → E: Small decrease in affinity for C.botulinum BoNT/A, increased efficiency of BoNT/C cleavage. 2 Publications1
Mutagenesisi166D → A: Decreased cleavage by BoNT/C, no change in cleavage by BoNT/A. 1 Publication1
Mutagenesisi167M → E: Small decrease in affinity for C.botulinum BoNT/A. 1 Publication1
Mutagenesisi199A → R: Not cleaved by BoNT/C. 1 Publication1
Mutagenesisi202M → Y: Slight decrease in affinity for BoNT/A, increases kcat for BoNT/A. 1 Publication1

Keywords - Diseasei

Congenital myasthenic syndrome, Disease mutation, Mental retardation

Organism-specific databases

DisGeNET

More...
DisGeNETi
6616

MalaCards human disease database

More...
MalaCardsi
SNAP25
MIMi616330 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000132639

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
98914 Presynaptic congenital myasthenic syndromes

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA35980

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2364159

Drug and drug target database

More...
DrugBanki
DB00083 Botulinum Toxin Type A

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SNAP25

Domain mapping of disease mutations (DMDM)

More...
DMDMi
46397726

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002135871 – 206Synaptosomal-associated protein 25Add BLAST206

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi85S-palmitoyl cysteineBy similarity1
Lipidationi88S-palmitoyl cysteineBy similarity1
Lipidationi90S-palmitoyl cysteineBy similarity1
Lipidationi92S-palmitoyl cysteineBy similarity1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei138PhosphothreonineBy similarity1
Modified residuei154PhosphoserineBy similarity1
Modified residuei187PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Palmitoylated (PubMed:28757145). Cys-85 appears to be the main site, and palmitoylation is required for membrane association (By similarity).By similarity1 Publication
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type A (BoNT/A, botA) which hydrolyzes the 197-Gln-|-Arg-198 bond and inhibits neurotransmitter release (PubMed:15592454, PubMed:9886085).1 Publication1 Publication
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type C (BoNT/C) which hydrolyzes the 198-Arg-|-Ala-199 bond and inhibits neurotransmitter release (PubMed:9886085, PubMed:17718519). C.botulinum type C only rarely infects humans.2 Publications
(Microbial infection) Targeted and hydrolyzed by C.botulinum neurotoxin type E (BoNT/E) which hydrolyzes the 180-Arg-|-Ile-181 bond and inhibits neurotransmitter release (PubMed:9886085).1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P60880

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P60880

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P60880

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P60880

PeptideAtlas

More...
PeptideAtlasi
P60880

PRoteomics IDEntifications database

More...
PRIDEi
P60880

ProteomicsDB human proteome resource

More...
ProteomicsDBi
57231
57232 [P60880-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P60880

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P60880

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P60880

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P60880

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Neurons of the neocortex, hippocampus, piriform cortex, anterior thalamic nuclei, pontine nuclei, and granule cells of the cerebellum.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000132639 Expressed in 159 organ(s), highest expression level in frontal cortex

CleanEx database of gene expression profiles

More...
CleanExi
HS_SNAP25

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P60880 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P60880 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB000360
HPA001830

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Part of the SNARE core complex containing SNAP25, VAMP2 and STX1A; this complex binds CPLX1 (PubMed:11832227). Found in a complex containing SYT1, SV2B and syntaxin-1 (By similarity). Found in a ternary complex with STX1A and VAMP8 (By similarity). Isoform 1 and isoform 2 interact with BLOC1S6 (PubMed:19546860). Interacts with CENPF (By similarity). Interacts with EQTN (By similarity). Interacts with HGS (By similarity). Interacts with KCNB1 (via N-terminus); reduces the voltage-dependent potassium channel KCNB1 activity in pancreatic beta cells (By similarity). Interacts with OTOF (By similarity). Interacts with RIMS1 (By similarity). Interacts with SNAPIN (By similarity). Interacts with STXBP6 (By similarity). Interacts with TRIM9 (By similarity). Interacts with ZDHHC13 (via ANK repeats) (By similarity). Interacts with ZDHHC17 (via ANK repeats) (PubMed:28882895, PubMed:28757145). Interacts with PLCL1 (via C2 domain) (By similarity). Associates with the BLOC-1 complex (PubMed:19546860). Interacts with PRRT2; this interaction may impair the formation of the SNARE complex (PubMed:22832103, PubMed:25915028).By similarity6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
112500, 34 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P60880

Database of interacting proteins

More...
DIPi
DIP-34554N

Protein interaction database and analysis system

More...
IntActi
P60880, 19 interactors

Molecular INTeraction database

More...
MINTi
P60880

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000254976

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1206
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1KILX-ray2.30C10-81[»]
D139-204[»]
1XTGX-ray2.10B146-204[»]
2N1TNMR-C7-83[»]
D131-204[»]
3DDAX-ray1.50B197-202[»]
3DDBX-ray1.60B198-202[»]
3RK2X-ray2.20C/G7-82[»]
D/H141-203[»]
3RK3X-ray3.50C7-82[»]
D141-203[»]
3RL0X-ray3.80C/G/K/O/S/W/a/e7-82[»]
D/H/L/P/T/X/b/f141-203[»]
3ZURX-ray2.71A/B145-206[»]
5W7IX-ray2.10B/D111-120[»]
5W7JX-ray2.20B/D111-120[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P60880

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P60880

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P60880

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini19 – 81t-SNARE coiled-coil homology 1PROSITE-ProRule annotationAdd BLAST63
Domaini140 – 202t-SNARE coiled-coil homology 2PROSITE-ProRule annotationAdd BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 75Interaction with CENPFBy similarityAdd BLAST75
Regioni111 – 120Interaction with ZDHHC171 Publication10

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi85 – 92Cys-rich8

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SNAP-25 family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3065 Eukaryota
ENOG410Y3Y0 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000012186

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG056971

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P60880

KEGG Orthology (KO)

More...
KOi
K18211

Identification of Orthologs from Complete Genome Data

More...
OMAi
GEMDENL

Database of Orthologous Groups

More...
OrthoDBi
1197028at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P60880

TreeFam database of animal gene trees

More...
TreeFami
TF315125

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000928 SNAP-25
IPR039077 SNAP25
IPR000727 T_SNARE_dom

The PANTHER Classification System

More...
PANTHERi
PTHR19305:SF5 PTHR19305:SF5, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00835 SNAP-25, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00397 t_SNARE, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50192 T_SNARE, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Isoforms differ by the usage of two alternative homologous exons (5a and 5b) which code for positions 56 to 94 and differ only in 9 positions out of 39.

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P60880-1) [UniParc]FASTAAdd to basket
Also known as: SNAP-25b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEDADMRNE LEEMQRRADQ LADESLESTR RMLQLVEESK DAGIRTLVML
60 70 80 90 100
DEQGEQLERI EEGMDQINKD MKEAEKNLTD LGKFCGLCVC PCNKLKSSDA
110 120 130 140 150
YKKAWGNNQD GVVASQPARV VDEREQMAIS GGFIRRVTND ARENEMDENL
160 170 180 190 200
EQVSGIIGNL RHMALDMGNE IDTQNRQIDR IMEKADSNKT RIDEANQRAT

KMLGSG
Length:206
Mass (Da):23,315
Last modified:April 13, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFBED2B082A4CB6A6
GO
Isoform 2 (identifier: P60880-2) [UniParc] [UniParc]FASTAAdd to basket
Also known as: SNAP-25a

The sequence of this isoform differs from the canonical sequence as follows:
     58-89: ERIEEGMDQINKDMKEAEKNLTDLGKFCGLCV → DRVEEGMNHINQDMKEAEKNLKDLGKCCGLFI

Show »
Length:206
Mass (Da):23,336
Checksum:iE272652C701EA984
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MSS0A0A0A0MSS0_HUMAN
Synaptosomal-associated protein 25
SNAP25
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti44I → V in BAD97337 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07369867I → N in CMS18; interfers with calcium-induced fusion; inhibits exocytosis of catecholamine-containing vesicles. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_00618658 – 89ERIEE…CGLCV → DRVEEGMNHINQDMKEAEKN LKDLGKCCGLFI in isoform 2. 5 PublicationsAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L19760 mRNA Translation: AAC37545.1
L19761 mRNA Translation: AAC37546.1
D21267 mRNA Translation: BAA22370.1
BT019684 mRNA Translation: AAV38490.1
AK223617 mRNA Translation: BAD97337.1
AK289647 mRNA Translation: BAF82336.1
AK314359 mRNA Translation: BAG36991.1
AL023913 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10346.1
CH471133 Genomic DNA Translation: EAX10349.1
CH471133 Genomic DNA Translation: EAX10350.1
CH471133 Genomic DNA Translation: EAX10352.1
BC010647 mRNA Translation: AAH10647.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13109.1 [P60880-2]
CCDS13110.1

Protein sequence database of the Protein Information Resource

More...
PIRi
I53735
I67823

NCBI Reference Sequences

More...
RefSeqi
NP_001309831.1, NM_001322902.1 [P60880-2]
NP_001309832.1, NM_001322903.1 [P60880-1]
NP_001309833.1, NM_001322904.1 [P60880-1]
NP_001309834.1, NM_001322905.1 [P60880-1]
NP_001309835.1, NM_001322906.1 [P60880-1]
NP_001309836.1, NM_001322907.1 [P60880-1]
NP_001309837.1, NM_001322908.1 [P60880-1]
NP_001309838.1, NM_001322909.1 [P60880-1]
NP_001309839.1, NM_001322910.1 [P60880-1]
NP_003072.2, NM_003081.4 [P60880-2]
NP_570824.1, NM_130811.3 [P60880-1]
XP_005260865.1, XM_005260808.4 [P60880-1]
XP_016883510.1, XM_017028021.1 [P60880-2]
XP_016883511.1, XM_017028022.1 [P60880-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.167317

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000254976; ENSP00000254976; ENSG00000132639 [P60880-1]
ENST00000304886; ENSP00000307341; ENSG00000132639 [P60880-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
6616

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:6616

UCSC genome browser

More...
UCSCi
uc002wnq.3 human

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L19760 mRNA Translation: AAC37545.1
L19761 mRNA Translation: AAC37546.1
D21267 mRNA Translation: BAA22370.1
BT019684 mRNA Translation: AAV38490.1
AK223617 mRNA Translation: BAD97337.1
AK289647 mRNA Translation: BAF82336.1
AK314359 mRNA Translation: BAG36991.1
AL023913 Genomic DNA No translation available.
CH471133 Genomic DNA Translation: EAX10346.1
CH471133 Genomic DNA Translation: EAX10349.1
CH471133 Genomic DNA Translation: EAX10350.1
CH471133 Genomic DNA Translation: EAX10352.1
BC010647 mRNA Translation: AAH10647.1
CCDSiCCDS13109.1 [P60880-2]
CCDS13110.1
PIRiI53735
I67823
RefSeqiNP_001309831.1, NM_001322902.1 [P60880-2]
NP_001309832.1, NM_001322903.1 [P60880-1]
NP_001309833.1, NM_001322904.1 [P60880-1]
NP_001309834.1, NM_001322905.1 [P60880-1]
NP_001309835.1, NM_001322906.1 [P60880-1]
NP_001309836.1, NM_001322907.1 [P60880-1]
NP_001309837.1, NM_001322908.1 [P60880-1]
NP_001309838.1, NM_001322909.1 [P60880-1]
NP_001309839.1, NM_001322910.1 [P60880-1]
NP_003072.2, NM_003081.4 [P60880-2]
NP_570824.1, NM_130811.3 [P60880-1]
XP_005260865.1, XM_005260808.4 [P60880-1]
XP_016883510.1, XM_017028021.1 [P60880-2]
XP_016883511.1, XM_017028022.1 [P60880-2]
UniGeneiHs.167317

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1KILX-ray2.30C10-81[»]
D139-204[»]
1XTGX-ray2.10B146-204[»]
2N1TNMR-C7-83[»]
D131-204[»]
3DDAX-ray1.50B197-202[»]
3DDBX-ray1.60B198-202[»]
3RK2X-ray2.20C/G7-82[»]
D/H141-203[»]
3RK3X-ray3.50C7-82[»]
D141-203[»]
3RL0X-ray3.80C/G/K/O/S/W/a/e7-82[»]
D/H/L/P/T/X/b/f141-203[»]
3ZURX-ray2.71A/B145-206[»]
5W7IX-ray2.10B/D111-120[»]
5W7JX-ray2.20B/D111-120[»]
ProteinModelPortaliP60880
SMRiP60880
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112500, 34 interactors
CORUMiP60880
DIPiDIP-34554N
IntActiP60880, 19 interactors
MINTiP60880
STRINGi9606.ENSP00000254976

Chemistry databases

ChEMBLiCHEMBL2364159
DrugBankiDB00083 Botulinum Toxin Type A

Protein family/group databases

TCDBi1.F.1.1.1 the synaptosomal vesicle fusion pore (svf-pore) family

PTM databases

iPTMnetiP60880
PhosphoSitePlusiP60880
SwissPalmiP60880

Polymorphism and mutation databases

BioMutaiSNAP25
DMDMi46397726

Proteomic databases

EPDiP60880
jPOSTiP60880
MaxQBiP60880
PaxDbiP60880
PeptideAtlasiP60880
PRIDEiP60880
ProteomicsDBi57231
57232 [P60880-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
6616
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000254976; ENSP00000254976; ENSG00000132639 [P60880-1]
ENST00000304886; ENSP00000307341; ENSG00000132639 [P60880-2]
GeneIDi6616
KEGGihsa:6616
UCSCiuc002wnq.3 human

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
6616
DisGeNETi6616
EuPathDBiHostDB:ENSG00000132639.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SNAP25
HGNCiHGNC:11132 SNAP25
HPAiCAB000360
HPA001830
MalaCardsiSNAP25
MIMi600322 gene
616330 phenotype
neXtProtiNX_P60880
OpenTargetsiENSG00000132639
Orphaneti98914 Presynaptic congenital myasthenic syndromes
PharmGKBiPA35980

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3065 Eukaryota
ENOG410Y3Y0 LUCA
GeneTreeiENSGT00390000012186
HOVERGENiHBG056971
InParanoidiP60880
KOiK18211
OMAiGEMDENL
OrthoDBi1197028at2759
PhylomeDBiP60880
TreeFamiTF315125

Enzyme and pathway databases

ReactomeiR-HSA-181429 Serotonin Neurotransmitter Release Cycle
R-HSA-181430 Norepinephrine Neurotransmitter Release Cycle
R-HSA-210500 Glutamate Neurotransmitter Release Cycle
R-HSA-212676 Dopamine Neurotransmitter Release Cycle
R-HSA-264642 Acetylcholine Neurotransmitter Release Cycle
R-HSA-422356 Regulation of insulin secretion
R-HSA-449836 Other interleukin signaling
R-HSA-5250968 Toxicity of botulinum toxin type A (BoNT/A)
R-HSA-5250971 Toxicity of botulinum toxin type C (BoNT/C)
R-HSA-5250992 Toxicity of botulinum toxin type E (BoNT/E)
R-HSA-6798695 Neutrophil degranulation
R-HSA-888590 GABA synthesis, release, reuptake and degradation
SIGNORiP60880

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SNAP25 human
EvolutionaryTraceiP60880

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
SNAP25

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
6616
PMAP-CutDBiP60880

Protein Ontology

More...
PROi
PR:P60880

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000132639 Expressed in 159 organ(s), highest expression level in frontal cortex
CleanExiHS_SNAP25
ExpressionAtlasiP60880 baseline and differential
GenevisibleiP60880 HS

Family and domain databases

InterProiView protein in InterPro
IPR000928 SNAP-25
IPR039077 SNAP25
IPR000727 T_SNARE_dom
PANTHERiPTHR19305:SF5 PTHR19305:SF5, 1 hit
PfamiView protein in Pfam
PF00835 SNAP-25, 1 hit
SMARTiView protein in SMART
SM00397 t_SNARE, 2 hits
PROSITEiView protein in PROSITE
PS50192 T_SNARE, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSNP25_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P60880
Secondary accession number(s): B2RAU4
, D3DW16, D3DW17, P13795, P36974, P70557, P70558, Q53EM2, Q5U0B5, Q8IXK3, Q96FM2, Q9BR45
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: April 13, 2004
Last modified: January 16, 2019
This is version 163 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again