UniProtKB - P60619 (RL37A_HALMA)

BLAST

>sp|P60619|RL37A_HALMA 50S ribosomal protein L37Ae OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) OX=272569 GN=rpl37ae PE=1 SV=2
MASKSGKTGSSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYC
DYKFTGGSYKPETPGGKTVRRSIRAALSEDEE

Align
Format
Add to basket Added to basket
History
Entry version 106 (10 Oct 2018)
Sequence version 2 (04 Jan 2005)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

50S ribosomal protein L37Ae

Gene

rpl37ae

Organism

Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Binds to the 23S rRNA.

Cofactorⁱ

Zn²⁺CuratedNote: Binds 1 zinc ion per subunit.Curated

Sites

Feature key	Position(s)	DescriptionActions	Length
Metal bindingⁱ	39	ZincUniRule annotation	1
Metal bindingⁱ	42	ZincUniRule annotation	1
Metal bindingⁱ	57	ZincUniRule annotation	1
Metal bindingⁱ	60	ZincUniRule annotation	1

Regions

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Zinc fingerⁱ	39 – 60	C4-typeUniRule annotationAdd BLAST		22

GO - Molecular functionⁱ

large ribosomal subunit rRNA binding Source: UniProtKB-UniRule
structural constituent of ribosome Source: InterPro
zinc ion binding Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

translation Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding
Ligand	Metal-binding, Zinc

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 50S ribosomal protein L37AeUniRule annotation Alternative name(s): Ribosomal protein L43eUniRule annotation
Gene namesⁱ	Name:rpl37aeUniRule annotation Ordered Locus Names:rrnAC1669
Organismⁱ	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)
Taxonomic identifierⁱ	272569 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Archaea › Euryarchaeota › Stenosarchaea group › Halobacteria › Halobacteriales › Haloarculaceae › Haloarcula › Haloarcula marismortui
Proteomesⁱ	UP000001169 Componentⁱ: Chromosome I

Subcellular locationⁱ

GO - Cellular componentⁱ

ribosome Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000139841	1 – 92	50S ribosomal protein L37AeAdd BLAST		92

Interactionⁱ

Subunit structureⁱ

Part of the 50S ribosomal subunit. Contacts protein L2.UniRule annotation2 Publications

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1669

STRINGⁱ

272569.rrnAC1669

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	11 – 14	Combined sources	4
Helixⁱ	20 – 34	Combined sources	15
Beta strandⁱ	37 – 39	Combined sources	3
Beta strandⁱ	40 – 42	Combined sources	3
Beta strandⁱ	45 – 51	Combined sources	7
Beta strandⁱ	54 – 57	Combined sources	4
Turnⁱ	58 – 60	Combined sources	3
Beta strandⁱ	63 – 65	Combined sources	3
Beta strandⁱ	68 – 72	Combined sources	5
Helixⁱ	74 – 81	Combined sources	8

Show more details

3D structure databases

ProteinModelPortalⁱ	P60619
SMRⁱ	P60619
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P60619

EvolutionaryTraceⁱ

P60619

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the eukaryotic ribosomal protein eL43 family. Putative zinc-binding subfamily.UniRule annotation

Zinc finger

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Zinc fingerⁱ	39 – 60	C4-typeUniRule annotationAdd BLAST		22

Keywords - Domainⁱ

Zinc-finger

Phylogenomic databases

eggNOGⁱ	arCOG04208 Archaea COG1997 LUCA
HOGENOMⁱ	HOG000229493
KEGG Orthology (KO) More...KOⁱ	K02921
Database of Orthologous Groups More...OrthoDBⁱ	POG093Z0L6X

Family and domain databases

Gene3Dⁱ	2.20.25.30, 1 hit
HAMAPⁱ	MF_00327 Ribosomal_L37Ae, 1 hit
InterProⁱ	View protein in InterPro IPR002674 Ribosomal_L37ae IPR011331 Ribosomal_L37ae/L37e IPR011332 Ribosomal_zn-bd
PANTHERⁱ	PTHR43931 PTHR43931, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF01780 Ribosomal_L37ae, 1 hit
SUPFAMⁱ	SSF57829 SSF57829, 1 hit
TIGRFAMsⁱ	TIGR00280 eL43_euk_arch, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

P60619-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MASKSGKTGS SGRFGARYGR VSRRRVAEIE SEMNEDHACP NCGEDRVDRQ 
        60         70         80         90 
GTGIWQCSYC DYKFTGGSYK PETPGGKTVR RSIRAALSED EE

Length:92

Mass (Da):10,172

Last modified:January 4, 2005 - v2

Checksum:ⁱ89E52AFE761E9837

Sequence cautionⁱ

The sequence AAV46581 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AY596297 Genomic DNA Translation: AAV46581.1 Different initiation.

Select the link destinations:
EMBLⁱ
GenBankⁱ
DDBJⁱ

Links Updated

AY596297 Genomic DNA Translation: AAV46581.1 Different initiation.

Genome annotation databases

EnsemblBacteriaⁱ	AAV46581; AAV46581; rrnAC1669
KEGGⁱ	hma:rrnAC1669
PATRICⁱ	fig\|272569.17.peg.2356

Protein	Similar proteins		Species	Score	Length	Source
P60619	50S ribosomal protein L37Ae		Haloarcula hispanica N601		123	UniRef100_P60619
50S ribosomal protein L37Ae		Haloarcula amylolytica JCM 13557		102
50S ribosomal protein L37Ae		Haloarcula sp. K1		102
50S ribosomal protein L37Ae		Haloarcula sinaiiensis ATCC 33800		102
50S ribosomal protein L37Ae		Haloarcula argentinensis DSM 12282		102
+3

Protein	Similar proteins		Species	Score	Length	Source
P60619	50S ribosomal protein L37Ae		Haloarcula hispanica N601		123	UniRef90_P60619
50S ribosomal protein L37Ae		Haloarcula amylolytica JCM 13557		102
50S ribosomal protein L37Ae		Haloarcula sp. K1		102
50S ribosomal protein L37Ae		Haloarcula sinaiiensis ATCC 33800		102
50S ribosomal protein L37Ae		Haloarcula argentinensis DSM 12282		102
+10

Protein	Similar proteins		Species	Score	Length	Source
P60619	50S ribosomal protein L37Ae		HALS3		95	UniRef50_P60619
50S ribosomal protein L37Ae		HALSA		95
50S ribosomal protein L37Ae		Haloarcula hispanica N601		123
50S ribosomal protein L37Ae		Haloarcula amylolytica JCM 13557		102
50S ribosomal protein L37Ae		Haloarcula sp. K1		102
+65

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AY596297 Genomic DNA Translation: AAV46581.1 Different initiation.

Select the link destinations:
EMBLⁱ
GenBankⁱ
DDBJⁱ

Links Updated

AY596297 Genomic DNA Translation: AAV46581.1 Different initiation.

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1FFK	X-ray	2.40	W	12-19	[»]
	1JJ2	X-ray	2.40	Y	49-79	[»]
	1K73	X-ray	3.01	1	49-79	[»]
	1K8A	X-ray	3.00	1	49-79	[»]
	1K9M	X-ray	3.00	1	49-79	[»]
	1KC8	X-ray	3.01	1	49-79	[»]
	1KD1	X-ray	3.00	1	49-79	[»]
	1KQS	X-ray	3.10	Y	49-79	[»]
	1M1K	X-ray	3.20	1	49-79	[»]
	1M90	X-ray	2.80	1	49-79	[»]
	1N8R	X-ray	3.00	1	49-79	[»]
	1NJI	X-ray	3.00	1	49-79	[»]
	1Q7Y	X-ray	3.20	1	49-79	[»]
	1Q81	X-ray	2.95	1	49-79	[»]
	1Q82	X-ray	2.98	1	49-79	[»]
	1Q86	X-ray	3.00	1	49-79	[»]
	1QVF	X-ray	3.10	Y	49-79	[»]
	1QVG	X-ray	2.90	Y	49-79	[»]
	1S72	X-ray	2.40	Z	11-82	[»]
	1VQ4	X-ray	2.70	Z	11-92	[»]
	1VQ5	X-ray	2.60	Z	11-92	[»]
	1VQ6	X-ray	2.70	Z	11-92	[»]
	1VQ7	X-ray	2.50	Z	11-92	[»]
	1VQ8	X-ray	2.20	Z	11-92	[»]
	1VQ9	X-ray	2.40	Z	11-92	[»]
	1VQK	X-ray	2.30	Z	11-92	[»]
	1VQL	X-ray	2.30	Z	11-92	[»]
	1VQM	X-ray	2.30	Z	11-92	[»]
	1VQN	X-ray	2.40	Z	11-92	[»]
	1VQO	X-ray	2.20	Z	11-92	[»]
	1VQP	X-ray	2.25	Z	11-92	[»]
	1W2B	X-ray	3.50	Y	49-79	[»]
	1YHQ	X-ray	2.40	Z	11-92	[»]
	1YI2	X-ray	2.65	Z	11-92	[»]
	1YIJ	X-ray	2.60	Z	11-92	[»]
	1YIT	X-ray	2.80	Z	11-92	[»]
	1YJ9	X-ray	2.90	Z	11-92	[»]
	1YJN	X-ray	3.00	Z	11-92	[»]
	1YJW	X-ray	2.90	Z	11-92	[»]
	2OTJ	X-ray	2.90	Z	11-82	[»]
	2OTL	X-ray	2.70	Z	11-82	[»]
	2QA4	X-ray	3.00	Z	1-92	[»]
	2QEX	X-ray	2.90	Z	11-82	[»]
	3CC2	X-ray	2.40	Z	1-92	[»]
	3CC4	X-ray	2.70	Z	1-92	[»]
	3CC7	X-ray	2.70	Z	1-92	[»]
	3CCE	X-ray	2.75	Z	1-92	[»]
	3CCJ	X-ray	2.70	Z	1-92	[»]
	3CCL	X-ray	2.90	Z	1-92	[»]
	3CCM	X-ray	2.55	Z	1-92	[»]
	3CCQ	X-ray	2.90	Z	1-92	[»]
	3CCR	X-ray	3.00	Z	1-92	[»]
	3CCS	X-ray	2.95	Z	1-92	[»]
	3CCU	X-ray	2.80	Z	1-92	[»]
	3CCV	X-ray	2.90	Z	1-92	[»]
	3CD6	X-ray	2.75	Z	1-92	[»]
	3CMA	X-ray	2.80	Z	1-92	[»]
	3CME	X-ray	2.95	Z	1-92	[»]
	3CPW	X-ray	2.70	Y	1-92	[»]
	3G4S	X-ray	3.20	Z	10-82	[»]
	3G6E	X-ray	2.70	Z	10-82	[»]
	3G71	X-ray	2.85	Z	10-82	[»]
	3I55	X-ray	3.11	Z	1-92	[»]
3I56	X-ray	2.90	Z	1-92	[»]
4ADX	electron microscopy	6.60	Z	1-92	[»]
4V9F	X-ray	2.40	Z	1-92	[»]
ProteinModelPortalⁱ	P60619
SMRⁱ	P60619
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC1669

STRINGⁱ

272569.rrnAC1669

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAV46581; AAV46581; rrnAC1669
KEGGⁱ	hma:rrnAC1669
PATRICⁱ	fig\|272569.17.peg.2356

Phylogenomic databases

eggNOGⁱ	arCOG04208 Archaea COG1997 LUCA
HOGENOMⁱ	HOG000229493
KOⁱ	K02921
OrthoDBⁱ	POG093Z0L6X

Miscellaneous databases

EvolutionaryTraceⁱ	P60619

EvolutionaryTraceⁱ

P60619

Family and domain databases

Gene3Dⁱ	2.20.25.30, 1 hit
HAMAPⁱ	MF_00327 Ribosomal_L37Ae, 1 hit
InterProⁱ	View protein in InterPro IPR002674 Ribosomal_L37ae IPR011331 Ribosomal_L37ae/L37e IPR011332 Ribosomal_zn-bd
PANTHERⁱ	PTHR43931 PTHR43931, 1 hit
Pfamⁱ	View protein in Pfam PF01780 Ribosomal_L37ae, 1 hit
SUPFAMⁱ	SSF57829 SSF57829, 1 hit
TIGRFAMsⁱ	TIGR00280 eL43_euk_arch, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RL37A_HALMA
Accessionⁱ	P60619Primary (citable) accession number: P60619 Secondary accession number(s): Q5V1M1
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	March 15, 2004
	Last sequence update:	January 4, 2005
	Last modified:	October 10, 2018
	This is version 106 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P60619 (RL37A_HALMA)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

50S ribosomal protein L37Ae

rpl37ae

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

Regions

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Keywords - Domaini

Phylogenomic databases

Family and domain databases

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Sequence cautionⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ