UniProtKB - P60618 (RL15E_HALMA)

BLAST

>sp|P60618|RL15E_HALMA 50S ribosomal protein L15e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) OX=272569 GN=rpl15e PE=1 SV=3
MARSAYSYIRDAWKNPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQG
VIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYS
VGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKG
SEKTRPSLRSNGGKGK

Align
Format
Add to basket Added to basket
History
Entry version 104 (10 Oct 2018)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

50S ribosomal protein L15e

Gene

rpl15e

Organism

Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

GO - Molecular functionⁱ

rRNA binding Source: UniProtKB-KW
structural constituent of ribosome Source: InterPro

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

translation Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Molecular function

Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 50S ribosomal protein L15e Alternative name(s): 50S ribosomal protein LC12
Gene namesⁱ	Name:rpl15e Ordered Locus Names:rrnAC2065
Organismⁱ	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)
Taxonomic identifierⁱ	272569 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Archaea › Euryarchaeota › Stenosarchaea group › Halobacteria › Halobacteriales › Haloarculaceae › Haloarcula › Haloarcula marismortui
Proteomesⁱ	UP000001169 Componentⁱ: Chromosome I

Subcellular locationⁱ

GO - Cellular componentⁱ

ribosome Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Initiator methionineⁱ		Removed1 Publication
ChainⁱPRO_0000127570	2 – 196	50S ribosomal protein L15eAdd BLAST		195

Interactionⁱ

Subunit structureⁱ

Part of the 50S ribosomal subunit. Interacts with protein L7Ae and weakly with L44e.2 Publications

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC2065

STRINGⁱ

272569.rrnAC2065

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	6 – 12	Combined sources	7
Helixⁱ	19 – 32	Combined sources	14
Beta strandⁱ	33 – 35	Combined sources	3
Beta strandⁱ	37 – 43	Combined sources	7
Helixⁱ	47 – 53	Combined sources	7
Beta strandⁱ	61 – 69	Combined sources	9
Helixⁱ	84 – 86	Combined sources	3
Beta strandⁱ	89 – 91	Combined sources	3
Helixⁱ	98 – 109	Combined sources	12
Beta strandⁱ	114 – 124	Combined sources	11
Beta strandⁱ	127 – 135	Combined sources	9
Helixⁱ	140 – 143	Combined sources	4
Turnⁱ	146 – 148	Combined sources	3
Helixⁱ	149 – 152	Combined sources	4
Helixⁱ	154 – 156	Combined sources	3
Helixⁱ	159 – 162	Combined sources	4
Helixⁱ	166 – 171	Combined sources	6
Turnⁱ	182 – 184	Combined sources	3
Turnⁱ	188 – 192	Combined sources	5

Show more details

3D structure databases

ProteinModelPortalⁱ	P60618
SMRⁱ	P60618
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P60618

EvolutionaryTraceⁱ

P60618

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the eukaryotic ribosomal protein eL15 family.Curated

Phylogenomic databases

eggNOGⁱ	arCOG04209 Archaea COG1632 LUCA
HOGENOMⁱ	HOG000229584
KEGG Orthology (KO) More...KOⁱ	K02877
OMAⁱ	YWVAQDS
Database of Orthologous Groups More...OrthoDBⁱ	POG093Z0CHO

Family and domain databases

Gene3Dⁱ	3.40.1120.10, 1 hit
HAMAPⁱ	MF_00256 Ribosomal_L15e, 1 hit
InterProⁱ	View protein in InterPro IPR024794 Rbsml_L15e_core_dom_sf IPR000439 Ribosomal_L15e IPR020926 Ribosomal_L15e_arc IPR020925 Ribosomal_L15e_CS IPR012678 Ribosomal_L23/L15e_core_dom_sf
PANTHERⁱ	PTHR11847 PTHR11847, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00827 Ribosomal_L15e, 1 hit
SMARTⁱ	View protein in SMART SM01384 Ribosomal_L15e, 1 hit
SUPFAMⁱ	SSF54189 SSF54189, 1 hit
PROSITEⁱ	View protein in PROSITE PS01194 RIBOSOMAL_L15E, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P60618-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MARSAYSYIR DAWKNPGDGQ LAELQWQRQQ EWRNEGAVER IERPTRLDKA 
        60         70         80         90        100
RSQGYKAKQG VIVARVSVRK GSARKRRHKA GRRSKRQGVT RITRRKDIQR 
       110        120        130        140        150
VAEERASRTF PNLRVLNSYS VGQDGRQKWH EVILIDPNHP AIQNDDDLSW 
       160        170        180        190 
ICADDQADRV FRGLTGAGRR NRGLSGKGKG SEKTRPSLRS NGGKGK

Length:196

Mass (Da):22,355

Last modified:January 23, 2007 - v3

Checksum:ⁱ502449E0A6BC23BB

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	13	W → T AA sequence (PubMed:3196689).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AY596297 Genomic DNA Translation: AAV46920.1
PIRⁱ	H28949
NCBI Reference Sequences More...RefSeqⁱ	WP_004958369.1, NC_006396.1

Genome annotation databases

EnsemblBacteriaⁱ	AAV46920; AAV46920; rrnAC2065
GeneIDⁱ	3129041
KEGGⁱ	hma:rrnAC2065
PATRICⁱ	fig\|272569.17.peg.2714

Protein	Similar proteins		Species	Score	Length	Source
P60618	50S ribosomal protein L15e		Haloarcula sinaiiensis ATCC 33800		196	UniRef100_P60618
UPI00019D98F5		Haloarcula marismortui		194

Protein	Similar proteins		Species	Score	Length	Source
P60618	50S ribosomal protein L15e		Haloarcula sinaiiensis ATCC 33800		196	UniRef90_P60618
50S ribosomal protein L15e		HALHT		196
50S ribosomal protein L15e		Haloarcula amylolytica JCM 13557		196
50S ribosomal protein L15e		Haloarcula hispanica N601		196
50S ribosomal protein L15e		Haloarcula sp. K1		196
+15

Protein	Similar proteins		Species	Score	Length	Source
P60618	50S ribosomal protein L15e		METM6		194	UniRef50_P60618
50S ribosomal protein L15e		METM5		194
50S ribosomal protein L15e		METM7		194
50S ribosomal protein L15e		HALLT		196
50S ribosomal protein L15e		METMJ		196
+773

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AY596297 Genomic DNA Translation: AAV46920.1
PIRⁱ	H28949
RefSeqⁱ	WP_004958369.1, NC_006396.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1FFK	X-ray	2.40	I	37-194	[»]
	1JJ2	X-ray	2.40	L	2-194	[»]
	1K73	X-ray	3.01	N	2-194	[»]
	1K8A	X-ray	3.00	N	2-194	[»]
	1K9M	X-ray	3.00	N	2-194	[»]
	1KC8	X-ray	3.01	N	2-194	[»]
	1KD1	X-ray	3.00	N	2-194	[»]
	1KQS	X-ray	3.10	L	2-194	[»]
	1M1K	X-ray	3.20	N	2-194	[»]
	1M90	X-ray	2.80	N	2-194	[»]
	1N8R	X-ray	3.00	N	2-194	[»]
	1NJI	X-ray	3.00	N	2-194	[»]
	1Q7Y	X-ray	3.20	N	2-194	[»]
	1Q81	X-ray	2.95	N	2-194	[»]
	1Q82	X-ray	2.98	N	2-194	[»]
	1Q86	X-ray	3.00	N	2-194	[»]
	1QVF	X-ray	3.10	L	2-194	[»]
	1QVG	X-ray	2.90	L	2-194	[»]
	1S72	X-ray	2.40	M	2-194	[»]
	1VQ4	X-ray	2.70	M	2-194	[»]
	1VQ5	X-ray	2.60	M	2-194	[»]
	1VQ6	X-ray	2.70	M	2-194	[»]
	1VQ7	X-ray	2.50	M	2-194	[»]
	1VQ8	X-ray	2.20	M	2-194	[»]
	1VQ9	X-ray	2.40	M	1-194	[»]
	1VQK	X-ray	2.30	M	1-194	[»]
	1VQL	X-ray	2.30	M	1-194	[»]
	1VQM	X-ray	2.30	M	1-194	[»]
	1VQN	X-ray	2.40	M	2-194	[»]
	1VQO	X-ray	2.20	M	1-194	[»]
	1VQP	X-ray	2.25	M	1-194	[»]
	1W2B	X-ray	3.50	L	2-194	[»]
	1YHQ	X-ray	2.40	M	2-195	[»]
	1YI2	X-ray	2.65	M	1-195	[»]
	1YIJ	X-ray	2.60	M	1-195	[»]
	1YIT	X-ray	2.80	M	1-195	[»]
	1YJ9	X-ray	2.90	M	1-195	[»]
	1YJN	X-ray	3.00	M	1-195	[»]
	1YJW	X-ray	2.90	M	1-195	[»]
	2OTJ	X-ray	2.90	M	2-194	[»]
	2OTL	X-ray	2.70	M	2-194	[»]
	2QA4	X-ray	3.00	M	1-194	[»]
	2QEX	X-ray	2.90	M	1-194	[»]
	3CC2	X-ray	2.40	M	1-196	[»]
	3CC4	X-ray	2.70	M	1-196	[»]
	3CC7	X-ray	2.70	M	1-196	[»]
	3CCE	X-ray	2.75	M	1-196	[»]
	3CCJ	X-ray	2.70	M	1-196	[»]
	3CCL	X-ray	2.90	M	1-196	[»]
	3CCM	X-ray	2.55	M	1-196	[»]
	3CCQ	X-ray	2.90	M	1-196	[»]
	3CCR	X-ray	3.00	M	1-196	[»]
	3CCS	X-ray	2.95	M	1-196	[»]
	3CCU	X-ray	2.80	M	1-196	[»]
	3CCV	X-ray	2.90	M	1-196	[»]
	3CD6	X-ray	2.75	M	1-196	[»]
	3CMA	X-ray	2.80	M	1-196	[»]
	3CME	X-ray	2.95	M	1-196	[»]
	3CPW	X-ray	2.70	L	1-196	[»]
	3G4S	X-ray	3.20	M	2-195	[»]
	3G6E	X-ray	2.70	M	2-195	[»]
	3G71	X-ray	2.85	M	2-195	[»]
	3I55	X-ray	3.11	M	2-194	[»]
3I56	X-ray	2.90	M	2-194	[»]
4ADX	electron microscopy	6.60	M	1-196	[»]
4V9F	X-ray	2.40	M	1-196	[»]
ProteinModelPortalⁱ	P60618
SMRⁱ	P60618
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC2065

STRINGⁱ

272569.rrnAC2065

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAV46920; AAV46920; rrnAC2065
GeneIDⁱ	3129041
KEGGⁱ	hma:rrnAC2065
PATRICⁱ	fig\|272569.17.peg.2714

Phylogenomic databases

eggNOGⁱ	arCOG04209 Archaea COG1632 LUCA
HOGENOMⁱ	HOG000229584
KOⁱ	K02877
OMAⁱ	YWVAQDS
OrthoDBⁱ	POG093Z0CHO

Miscellaneous databases

EvolutionaryTraceⁱ	P60618

EvolutionaryTraceⁱ

P60618

Family and domain databases

Gene3Dⁱ	3.40.1120.10, 1 hit
HAMAPⁱ	MF_00256 Ribosomal_L15e, 1 hit
InterProⁱ	View protein in InterPro IPR024794 Rbsml_L15e_core_dom_sf IPR000439 Ribosomal_L15e IPR020926 Ribosomal_L15e_arc IPR020925 Ribosomal_L15e_CS IPR012678 Ribosomal_L23/L15e_core_dom_sf
PANTHERⁱ	PTHR11847 PTHR11847, 1 hit
Pfamⁱ	View protein in Pfam PF00827 Ribosomal_L15e, 1 hit
SMARTⁱ	View protein in SMART SM01384 Ribosomal_L15e, 1 hit
SUPFAMⁱ	SSF54189 SSF54189, 1 hit
PROSITEⁱ	View protein in PROSITE PS01194 RIBOSOMAL_L15E, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RL15E_HALMA
Accessionⁱ	P60618Primary (citable) accession number: P60618 Secondary accession number(s): P12740, Q5V0N3
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	March 15, 2004
	Last sequence update:	January 23, 2007
	Last modified:	October 10, 2018
	This is version 104 of the entry and version 3 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P60618 (RL15E_HALMA)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

50S ribosomal protein L15e

rpl15e

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ