UniProtKB - P60617 (RL10E_HALMA)

BLAST

>sp|P60617|RL10E_HALMA 50S ribosomal protein L10e OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) OX=272569 GN=rpl10e PE=1 SV=2
MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQL
RHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAF
GKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEELLIA

Align
Format
Add to basket Added to basket
History
Entry version 104 (10 Oct 2018)
Sequence version 2 (04 Jan 2005)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

50S ribosomal protein L10e

Gene

rpl10e

Organism

Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

This is 1 of 5 proteins that mediate the attachment of the 5S rRNA onto the large ribosomal subunit, stabilizing the orientation of adjacent RNA domains. Modeling places the A and P site tRNAs in close proximity to this protein.

GO - Molecular functionⁱ

rRNA binding Source: UniProtKB-KW
structural constituent of ribosome Source: InterPro
tRNA binding Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

translation Source: UniProtKB-UniRule

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, tRNA-binding

Molecular function

Ribonucleoprotein, Ribosomal protein, RNA-binding, rRNA-binding, tRNA-binding

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: 50S ribosomal protein L10eUniRule annotation
Gene namesⁱ	Name:rpl10eUniRule annotation Ordered Locus Names:rrnAC2357
Organismⁱ	Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) (Halobacterium marismortui)
Taxonomic identifierⁱ	272569 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Archaea › Euryarchaeota › Stenosarchaea group › Halobacteria › Halobacteriales › Haloarculaceae › Haloarcula › Haloarcula marismortui
Proteomesⁱ	UP000001169 Componentⁱ: Chromosome I

Subcellular locationⁱ

GO - Cellular componentⁱ

ribosome Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000147132	1 – 177	50S ribosomal protein L10eAdd BLAST		177

Interactionⁱ

Subunit structureⁱ

Part of the 50S ribosomal subunit. Weakly binds 5S rRNA. Probably binds the A and P site tRNAs.2 Publications

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC2357

STRINGⁱ

272569.rrnAC2357

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	6 – 8	Combined sources	3
Turnⁱ	20 – 22	Combined sources	3
Beta strandⁱ	34 – 37	Combined sources	4
Beta strandⁱ	40 – 42	Combined sources	3
Helixⁱ	43 – 45	Combined sources	3
Beta strandⁱ	47 – 56	Combined sources	10
Beta strandⁱ	58 – 61	Combined sources	4
Helixⁱ	62 – 80	Combined sources	19
Turnⁱ	81 – 83	Combined sources	3
Beta strandⁱ	87 – 90	Combined sources	4
Beta strandⁱ	96 – 100	Combined sources	5
Beta strandⁱ	116 – 118	Combined sources	3
Beta strandⁱ	122 – 130	Combined sources	9
Beta strandⁱ	135 – 141	Combined sources	7
Turnⁱ	143 – 145	Combined sources	3
Helixⁱ	146 – 156	Combined sources	11
Helixⁱ	157 – 159	Combined sources	3
Beta strandⁱ	160 – 162	Combined sources	3
Beta strandⁱ	164 – 166	Combined sources	3

Show more details

3D structure databases

ProteinModelPortalⁱ	P60617
SMRⁱ	P60617
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P60617

EvolutionaryTraceⁱ

P60617

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the universal ribosomal protein uL16 family.UniRule annotation

Phylogenomic databases

eggNOGⁱ	arCOG04113 Archaea COG0197 LUCA
HOGENOMⁱ	HOG000223755
KEGG Orthology (KO) More...KOⁱ	K02866
OMAⁱ	PYTRKEY
Database of Orthologous Groups More...OrthoDBⁱ	POG093Z0C8R

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd01433 Ribosomal_L16_L10e, 1 hit
Gene3Dⁱ	3.90.1170.10, 1 hit
HAMAPⁱ	MF_00448 Ribosomal_L10e, 1 hit
InterProⁱ	View protein in InterPro IPR001197 Ribosomal_L10e IPR016180 Ribosomal_L10e/L16 IPR036920 Ribosomal_L10e/L16_sf IPR022981 Ribosomal_L10e_arc IPR018255 Ribosomal_L10e_CS
PANTHERⁱ	PTHR11726 PTHR11726, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00252 Ribosomal_L16, 1 hit
PIRSFⁱ	PIRSF005590 Ribosomal_L10, 1 hit
SUPFAMⁱ	SSF54686 SSF54686, 1 hit
PROSITEⁱ	View protein in PROSITE PS01257 RIBOSOMAL_L10E, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

P60617-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MSDKPASMYR DIDKPAYTRR EYITGIPGSK IAQHKMGRKQ KDADDYPVQI 
        60         70         80         90        100
SLIVEETVQL RHGSLEASRL SANRHLIKEL GEEGDYKMTL RKFPHQVLRE 
       110        120        130        140        150
NKQATGAGAD RVSDGMRAAF GKIVGTAARV QAGEQLFTAY CNVEDAEHVK 
       160        170 
EAFRRAYNKI TPSCRIKVER GEELLIA

Length:177

Mass (Da):19,908

Last modified:January 4, 2005 - v2

Checksum:ⁱE7A72FE3683D2BDB

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AY596297 Genomic DNA Translation: AAV47175.1
NCBI Reference Sequences More...RefSeqⁱ	WP_007189393.1, NC_006396.1

Genome annotation databases

EnsemblBacteriaⁱ	AAV47175; AAV47175; rrnAC2357
GeneIDⁱ	3130436
KEGGⁱ	hma:rrnAC2357
PATRICⁱ	fig\|272569.17.peg.2976

Protein	Similar proteins		Species	Score	Length	Source
P60617	50S ribosomal protein L10e		Haloarcula californiae ATCC 33799		177	UniRef100_P60617
UPI0001C67B28		Haloarcula marismortui		174

Protein	Similar proteins		Species	Score	Length	Source
P60617	50S ribosomal protein L10e		Haloarcula californiae ATCC 33799		177	UniRef90_P60617
50S ribosomal protein L10e		Haloarcula amylolytica JCM 13557		177
50S ribosomal protein L10e		Haloarcula hispanica N601		177
50S ribosomal protein L10e		Haloarcula sp. K1		177
50S ribosomal protein L10e		Haloarcula sp. CBA1115		177
+12

Protein	Similar proteins		Species	Score	Length	Source
P60617	50S ribosomal protein L10e		METBF		173	UniRef50_P60617
50S ribosomal protein L10e		METMJ		170
50S ribosomal protein L10e		METPE		173
50S ribosomal protein L10e		HALS3		176
50S ribosomal protein L10e		HALSA		176
+476

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AY596297 Genomic DNA Translation: AAV47175.1
RefSeqⁱ	WP_007189393.1, NC_006396.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1FFK	X-ray	2.40	F	14-129	[»]
	1JJ2	X-ray	2.40	H	14-130	[»]
	1K73	X-ray	3.01	J	14-130	[»]
	1K8A	X-ray	3.00	J	14-130	[»]
	1K9M	X-ray	3.00	J	14-130	[»]
	1KC8	X-ray	3.01	J	14-130	[»]
	1KD1	X-ray	3.00	J	14-130	[»]
	1KQS	X-ray	3.10	H	14-130	[»]
	1M1K	X-ray	3.20	J	14-130	[»]
	1M90	X-ray	2.80	J	14-130	[»]
	1ML5	electron microscopy	14.00	p	18-129	[»]
	1N8R	X-ray	3.00	J	14-130	[»]
	1NJI	X-ray	3.00	J	14-130	[»]
	1Q7Y	X-ray	3.20	J	14-130	[»]
	1Q81	X-ray	2.95	J	14-130	[»]
	1Q82	X-ray	2.98	J	14-130	[»]
	1Q86	X-ray	3.00	J	14-130	[»]
	1QVF	X-ray	3.10	H	14-130	[»]
	1QVG	X-ray	2.90	H	14-130	[»]
	1S72	X-ray	2.40	H	4-166	[»]
	1VQ4	X-ray	2.70	H	4-166	[»]
	1VQ5	X-ray	2.60	H	4-166	[»]
	1VQ6	X-ray	2.70	H	4-166	[»]
	1VQ7	X-ray	2.50	H	4-166	[»]
	1VQ8	X-ray	2.20	H	4-166	[»]
	1VQ9	X-ray	2.40	H	4-166	[»]
	1VQK	X-ray	2.30	H	4-166	[»]
	1VQL	X-ray	2.30	H	4-166	[»]
	1VQM	X-ray	2.30	H	4-166	[»]
	1VQN	X-ray	2.40	H	4-166	[»]
	1VQO	X-ray	2.20	H	4-166	[»]
	1VQP	X-ray	2.25	H	4-166	[»]
	1W2B	X-ray	3.50	H	14-130	[»]
	1YHQ	X-ray	2.40	H	1-177	[»]
	1YI2	X-ray	2.65	H	1-177	[»]
	1YIJ	X-ray	2.60	H	1-177	[»]
	1YIT	X-ray	2.80	H	1-177	[»]
	1YJ9	X-ray	2.90	H	1-177	[»]
	1YJN	X-ray	3.00	H	1-177	[»]
	1YJW	X-ray	2.90	H	1-177	[»]
	2OTJ	X-ray	2.90	H	4-166	[»]
	2OTL	X-ray	2.70	H	4-166	[»]
	2QA4	X-ray	3.00	H	4-177	[»]
	2QEX	X-ray	2.90	H	1-177	[»]
	3CC2	X-ray	2.40	H	1-177	[»]
	3CC4	X-ray	2.70	H	1-177	[»]
	3CC7	X-ray	2.70	H	1-177	[»]
	3CCE	X-ray	2.75	H	1-177	[»]
	3CCJ	X-ray	2.70	H	1-177	[»]
	3CCL	X-ray	2.90	H	1-177	[»]
	3CCM	X-ray	2.55	H	1-177	[»]
	3CCQ	X-ray	2.90	H	1-177	[»]
	3CCR	X-ray	3.00	H	1-177	[»]
	3CCS	X-ray	2.95	H	1-177	[»]
	3CCU	X-ray	2.80	H	1-177	[»]
	3CCV	X-ray	2.90	H	1-177	[»]
	3CD6	X-ray	2.75	H	1-177	[»]
	3CMA	X-ray	2.80	H	1-177	[»]
	3CME	X-ray	2.95	H	1-177	[»]
	3CPW	X-ray	2.70	H	1-177	[»]
	3G4S	X-ray	3.20	H	1-177	[»]
	3G6E	X-ray	2.70	H	1-177	[»]
	3G71	X-ray	2.85	H	1-177	[»]
3I55	X-ray	3.11	H	1-166	[»]
3I56	X-ray	2.90	H	1-166	[»]
4ADX	electron microscopy	6.60	H	1-177	[»]
4V9F	X-ray	2.40	H	1-177	[»]
ProteinModelPortalⁱ	P60617
SMRⁱ	P60617
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

STRINGⁱ	272569.rrnAC2357

STRINGⁱ

272569.rrnAC2357

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAV47175; AAV47175; rrnAC2357
GeneIDⁱ	3130436
KEGGⁱ	hma:rrnAC2357
PATRICⁱ	fig\|272569.17.peg.2976

Phylogenomic databases

eggNOGⁱ	arCOG04113 Archaea COG0197 LUCA
HOGENOMⁱ	HOG000223755
KOⁱ	K02866
OMAⁱ	PYTRKEY
OrthoDBⁱ	POG093Z0C8R

Miscellaneous databases

EvolutionaryTraceⁱ	P60617

EvolutionaryTraceⁱ

P60617

Family and domain databases

CDDⁱ	cd01433 Ribosomal_L16_L10e, 1 hit
Gene3Dⁱ	3.90.1170.10, 1 hit
HAMAPⁱ	MF_00448 Ribosomal_L10e, 1 hit
InterProⁱ	View protein in InterPro IPR001197 Ribosomal_L10e IPR016180 Ribosomal_L10e/L16 IPR036920 Ribosomal_L10e/L16_sf IPR022981 Ribosomal_L10e_arc IPR018255 Ribosomal_L10e_CS
PANTHERⁱ	PTHR11726 PTHR11726, 1 hit
Pfamⁱ	View protein in Pfam PF00252 Ribosomal_L16, 1 hit
PIRSFⁱ	PIRSF005590 Ribosomal_L10, 1 hit
SUPFAMⁱ	SSF54686 SSF54686, 1 hit
PROSITEⁱ	View protein in PROSITE PS01257 RIBOSOMAL_L10E, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	RL10E_HALMA
Accessionⁱ	P60617Primary (citable) accession number: P60617 Secondary accession number(s): Q5UZX7
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	March 15, 2004
	Last sequence update:	January 4, 2005
	Last modified:	October 10, 2018
	This is version 104 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P60617 (RL10E_HALMA)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

50S ribosomal protein L10e

rpl10e

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protocols and materials databases

Genome annotation databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ