UniProtKB - P60301 (3SA3_NAJAT)

BLAST

>sp|P60301|3SA3_NAJAT Cytotoxin 3 OS=Naja atra OX=8656 PE=1 SV=1
MKTLLLTLVVVTIVCLDLGYTLKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCI
DVCPKSSLLVKYVCCNTDRCN

Align
Format
Add to basket Added to basket
History
Entry version 80 (23 May 2018)
Sequence version 1 (02 Feb 2004)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Cytotoxin 3

Gene

N/A

Organism

Naja atra (Chinese cobra)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Basic protein that binds to cell membrane and depolarizes cardiomyocytes. This cytotoxin also possesses lytic activity on many other cells, including red blood cells (PubMed:8182052). Interaction with sulfatides in the cell membrane induces pore formation and cell internalization. Cytotoxicity is due to pore formation, and to another mechanism independent of membrane-damaging activity. When internalized, it targets the mitochondrial membrane and induces mitochondrial swelling and fragmentation. It inhibits protein kinases C. It binds to the integrin alpha-V/beta-3 (ITGAV/ITGB3) with a moderate affinity (PubMed:16407244). It also binds with high affinity to heparin (PubMed:17685633).7 Publications

Miscellaneous

Is classified as a P-type cytotoxin, since a proline residue stands at position 30 (Pro-31 in standard classification).1 Publication

GO - Molecular functionⁱ

toxin activity Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

hemolysis in other organism Source: UniProtKB-KW

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	Cardiotoxin, Toxin
Biological process	Cytolysis, Hemolysis

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Cytotoxin 3 Alternative name(s): Cardiotoxin 31 Publication Short name: CTX-3 Short name: CTX3 Cardiotoxin A32 Publications Short name: CTX A32 Publications Cardiotoxin III1 Publication Cardiotoxin analog III Short name: CTX III
Organismⁱ	Naja atra (Chinese cobra)
Taxonomic identifierⁱ	8656 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Sauropsida › Sauria › Lepidosauria › Squamata › Bifurcata › Unidentata › Episquamata › Toxicofera › Serpentes › Colubroidea › Elapidae › Elapinae › Naja

Keywords - Cellular componentⁱ

Membrane, Secreted, Target cell membrane, Target membrane

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Signal peptideⁱ	1 – 21	3 PublicationsAdd BLAST		21
ChainⁱPRO_0000035370	22 – 81	Cytotoxin 3Add BLAST		60

Amino acid modifications

Feature key	Position(s)	DescriptionActions
Disulfide bondⁱ	24 ↔ 42	4 Publications
Disulfide bondⁱ	35 ↔ 59	4 Publications
Disulfide bondⁱ	63 ↔ 74	4 Publications
Disulfide bondⁱ	75 ↔ 80	4 Publications

Keywords - PTMⁱ

Disulfide bond

Expressionⁱ

Tissue specificityⁱ

Expressed by the venom gland.Curated

Interactionⁱ

Subunit structureⁱ

Monomer in solution; Homodimer and oligomer in the presence of negatively charged lipids forming a pore with a size ranging between 20 and 30 Angstroms (PubMed:16263708,PubMed:12660250). Interacts with Kv channel-interacting protein 1 (KCNIP1) in a calcium-independent manner (PubMed:15184042).3 Publications

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	23 – 25	Combined sources	3
Beta strandⁱ	32 – 34	Combined sources	3
Beta strandⁱ	36 – 38	Combined sources	3
Beta strandⁱ	41 – 47	Combined sources	7
Beta strandⁱ	49 – 51	Combined sources	3
Beta strandⁱ	56 – 62	Combined sources	7
Beta strandⁱ	68 – 75	Combined sources	8
Beta strandⁱ	77 – 79	Combined sources	3

Show more details

3D structure databases

ProteinModelPortalⁱ	P60301
SMRⁱ	P60301
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Miscellaneous databases

EvolutionaryTraceⁱ	P60301

EvolutionaryTraceⁱ

P60301

Family & Domainsⁱ

Sequence similaritiesⁱ

Belongs to the snake three-finger toxin family. Short-chain subfamily. Type IA cytotoxin sub-subfamily.Curated

Keywords - Domainⁱ

Signal

Phylogenomic databases

HOVERGENⁱ	HBG006553

HOVERGENⁱ

HBG006553

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd00206 snake_toxin, 1 hit
InterProⁱ	View protein in InterPro IPR003572 Cytotoxin_Cobra IPR003571 Snake_3FTx IPR018354 Snake_toxin_con_site IPR035076 Toxin/TOLIP
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00087 Toxin_TOLIP, 1 hit
PRINTSⁱ	PR00282 CYTOTOXIN
PROSITEⁱ	View protein in PROSITE PS00272 SNAKE_TOXIN, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

Sequence processingⁱ: The displayed sequence is further processed into a mature form.

P60301-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MKTLLLTLVV VTIVCLDLGY TLKCNKLVPL FYKTCPAGKN LCYKMFMVAT 
        60         70         80 
PKVPVKRGCI DVCPKSSLLV KYVCCNTDRC N

Length:81

Mass (Da):9,038

Last modified:February 2, 2004 - v1

Checksum:ⁱ70FE0A82FAC9DC95

Experimental Info

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Sequence conflictⁱ	9 – 11	VVV → EEE in CAB42055 (PubMed:10708798).Curated		3
Sequence conflictⁱ	59	C → R in CAA90963 (PubMed:8619792).Curated		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	Z54227 mRNA Translation: CAA90963.1 U58486 mRNA Translation: AAB18382.1 U42585 mRNA Translation: AAB01541.1 AJ007796 mRNA Translation: CAA07686.1 AJ238735 Genomic DNA Translation: CAB42055.1
PIRⁱ	JC4620 H3NJ3F

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P60301	Cytotoxin 3		NAJSP		81	UniRef100_P60301
Cytotoxin 4		NAJKA		81

Protein	Similar proteins		Species	Score	Length	Source
P60301	Cytotoxin 3		NAJSP		81	UniRef90_P60301
Cytotoxin 4		NAJKA		81
Cytotoxin 6		NAJAT		82
Cytotoxin 10		NAJAT		82
Cytotoxin 4a		NAJSP		81
+4

Protein	Similar proteins		Species	Score	Length	Source
P60301	Cytotoxin 3		NAJSP		81	UniRef50_P60301
Cytotoxin 4		NAJKA		81
Cytotoxin 6		NAJAT		82
Three-finger toxin 3FTx-3		MICCO		82
Toxin 3FTx-Oxy6		OXYMI		81
+59

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	Z54227 mRNA Translation: CAA90963.1 U58486 mRNA Translation: AAB18382.1 U42585 mRNA Translation: AAB01541.1 AJ007796 mRNA Translation: CAA07686.1 AJ238735 Genomic DNA Translation: CAB42055.1
PIRⁱ	JC4620 H3NJ3F

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	1H0J	X-ray	1.90	A/B/C	22-81	[»]
	1I02	NMR	-	A	22-81	[»]
	1XT3	X-ray	2.40	A/B	22-81	[»]
	2BHI	X-ray	2.31	A/B	22-81	[»]
	2CRS	NMR	-	A	22-81	[»]
	2CRT	NMR	-	A	22-81	[»]
ProteinModelPortalⁱ	P60301
SMRⁱ	P60301
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Phylogenomic databases

HOVERGENⁱ	HBG006553

HOVERGENⁱ

HBG006553

Miscellaneous databases

EvolutionaryTraceⁱ	P60301

EvolutionaryTraceⁱ

P60301

Family and domain databases

CDDⁱ	cd00206 snake_toxin, 1 hit
InterProⁱ	View protein in InterPro IPR003572 Cytotoxin_Cobra IPR003571 Snake_3FTx IPR018354 Snake_toxin_con_site IPR035076 Toxin/TOLIP
Pfamⁱ	View protein in Pfam PF00087 Toxin_TOLIP, 1 hit
PRINTSⁱ	PR00282 CYTOTOXIN
PROSITEⁱ	View protein in PROSITE PS00272 SNAKE_TOXIN, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	3SA3_NAJAT
Accessionⁱ	P60301Primary (citable) accession number: P60301 Secondary accession number(s): P01444, Q9PS23, Q9W6W7
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	July 21, 1986
	Last sequence update:	February 2, 2004
	Last modified:	May 23, 2018
	This is version 80 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Annotation program	Animal Toxin Annotation Program

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P60301 (3SA3_NAJAT)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Cytotoxin 3

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Miscellaneous

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted

Other locations

Extracellular region or secreted

Other locations

Keywords - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

Miscellaneous databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protocols and materials databases

Phylogenomic databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ