Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 133 (07 Apr 2021)
Sequence version 2 (20 Dec 2005)
Previous versions | rss
Add a publicationFeedback
Protein

D-amino acid oxidase activator

Gene

DAOA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Seems to activate D-amino acid oxidase.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
P59103

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
D-amino acid oxidase activator
Alternative name(s):
Protein G72
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:DAOA
Synonyms:G72
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 13

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21191, DAOA

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
607408, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P59103

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000182346.17

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Golgi apparatus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Schizophrenia (SCZD)1 Publication
Disease susceptibility may be associated with variants affecting the gene represented in this entry.
Disease descriptionA complex, multifactorial psychotic disorder or group of disorders characterized by disturbances in the form and content of thought (e.g. delusions, hallucinations), in mood (e.g. inappropriate affect), in sense of self and relationship to the external world (e.g. loss of ego boundaries, withdrawal), and in behavior (e.g bizarre or apparently purposeless behavior). Although it affects emotions, it is distinguished from mood disorders in which such disturbances are primary. Similarly, there may be mild impairment of cognitive function, and it is distinguished from the dementias in which disturbed cognitive function is considered primary. Some patients manifest schizophrenic as well as bipolar disorder symptoms and are often given the diagnosis of schizoaffective disorder.
Related information in OMIM

Keywords - Diseasei

Schizophrenia

Organism-specific databases

DisGeNET

More...
DisGeNETi
267012

MalaCards human disease database

More...
MalaCardsi
DAOA
MIMi181500, phenotype

Open Targets

More...
OpenTargetsi
ENSG00000182346

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134924986

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P59103, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
DAOA

Domain mapping of disease mutations (DMDM)

More...
DMDMi
84028201

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000797811 – 153D-amino acid oxidase activatorAdd BLAST153

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P59103

PRoteomics IDEntifications database

More...
PRIDEi
P59103

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
57133 [P59103-1]
57134 [P59103-2]
70872

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in amygdala, caudate nucleus, spinal cord and testis.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000182346, Expressed in muscle tissue and 16 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P59103, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P59103, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000182346, Not detected

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
129363, 4 interactors

Protein interaction database and analysis system

More...
IntActi
P59103, 1 interactor

Molecular INTeraction database

More...
MINTi
P59103

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000483757

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
P59103, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P59103

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502T4XP, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00410000028557

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_2557651_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P59103

Identification of Orthologs from Complete Genome Data

More...
OMAi
TSTKAEW

Database of Orthologous Groups

More...
OrthoDBi
1378516at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P59103

TreeFam database of animal gene trees

More...
TreeFami
TF354179

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027929, DAOA

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15199, DAOA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P59103-1) [UniParc]FASTAAdd to basket
Also known as: LG72

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLEKLMGADS LQLFRSRYTL GKIYFIGFQR SILLSKSENS LNSIAKETEE
60 70 80 90 100
GRETVTRKEG WKRRHEDGYL EMAQRHLQRS LCPWVSYLPQ PYAELEEVSS
110 120 130 140 150
HVGKVFMARN YEFLAYEASK DRRQPLERMW TCNYNQQKDQ SCNHKEITST

KAE
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Length:153
Mass (Da):18,108
Last modified:December 20, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i597E2DE432A48EAE
GO
Isoform 2 (identifier: P59103-2) [UniParc]FASTAAdd to basket
Also known as: SG72

The sequence of this isoform differs from the canonical sequence as follows:
     16-16: S → V
     17-153: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:16
Mass (Da):1,851
Checksum:iB7B6CDA012257A99
GO
Isoform 3 (identifier: P59103-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-71: Missing.

Show »
Length:82
Mass (Da):9,783
Checksum:iEB1DEE2851A277D7
GO
Isoform 4 (identifier: P59103-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-153: LEEVSSHVGK...HKEITSTKAE → HSKVILNGNLHCHFKRISQIFAGHFMEGDTEA

Show »
Length:126
Mass (Da):14,719
Checksum:i56FCB698164657FF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q8IWM3Q8IWM3_HUMAN
D-amino acid oxidase activator
DAOA G72
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2T115A2T115_HUMAN
D-amino acid oxidase activator
DAOA
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R0L0M0R0L0_HUMAN
D-amino acid oxidase activator
DAOA
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R2M6M0R2M6_HUMAN
D-amino acid oxidase activator
DAOA
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
M0R2W9M0R2W9_HUMAN
D-amino acid oxidase activator
DAOA
30Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01431330R → K1 PublicationCorresponds to variant dbSNP:rs2391191Ensembl.1
Natural variantiVAR_05094362K → E. Corresponds to variant dbSNP:rs9558562Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0442921 – 71Missing in isoform 3. 2 PublicationsAdd BLAST71
Alternative sequenceiVSP_00405316S → V in isoform 2. Curated1
Alternative sequenceiVSP_00405417 – 153Missing in isoform 2. CuratedAdd BLAST137
Alternative sequenceiVSP_04429395 – 153LEEVS…STKAE → HSKVILNGNLHCHFKRISQI FAGHFMEGDTEA in isoform 4. 1 PublicationAdd BLAST59

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AE014294 Genomic DNA Translation: AAN16027.1
AE014294 Genomic DNA Translation: AAN16028.1
AY138546 mRNA Translation: AAN08432.1
AY138547 mRNA Translation: AAN08433.1
AY170469 mRNA Translation: AAO12727.1
AY223901 mRNA Translation: AAO73604.1
DQ343761 mRNA Translation: ABC59904.1
DQ357223 mRNA Translation: ABC86111.1
AL359751 Genomic DNA No translation available.
CH471085 Genomic DNA Translation: EAX09080.1
BC121091 mRNA Translation: AAI21092.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41905.1 [P59103-1]
CCDS53880.1 [P59103-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001155284.1, NM_001161812.1
NP_001155286.1, NM_001161814.1 [P59103-3]
NP_758958.3, NM_172370.4 [P59103-1]
XP_005254099.1, XM_005254042.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000329625; ENSP00000329951; ENSG00000182346 [P59103-3]
ENST00000375936; ENSP00000365103; ENSG00000182346 [P59103-1]
ENST00000473269; ENSP00000470244; ENSG00000182346 [P59103-4]
ENST00000559369; ENSP00000453831; ENSG00000182346 [P59103-3]
ENST00000600388; ENSP00000472260; ENSG00000182346 [P59103-3]
ENST00000618629; ENSP00000483757; ENSG00000182346 [P59103-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
267012

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:267012

UCSC genome browser

More...
UCSCi
uc001vqb.5, human [P59103-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE014294 Genomic DNA Translation: AAN16027.1
AE014294 Genomic DNA Translation: AAN16028.1
AY138546 mRNA Translation: AAN08432.1
AY138547 mRNA Translation: AAN08433.1
AY170469 mRNA Translation: AAO12727.1
AY223901 mRNA Translation: AAO73604.1
DQ343761 mRNA Translation: ABC59904.1
DQ357223 mRNA Translation: ABC86111.1
AL359751 Genomic DNA No translation available.
CH471085 Genomic DNA Translation: EAX09080.1
BC121091 mRNA Translation: AAI21092.1
CCDSiCCDS41905.1 [P59103-1]
CCDS53880.1 [P59103-3]
RefSeqiNP_001155284.1, NM_001161812.1
NP_001155286.1, NM_001161814.1 [P59103-3]
NP_758958.3, NM_172370.4 [P59103-1]
XP_005254099.1, XM_005254042.1

3D structure databases

SMRiP59103
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi129363, 4 interactors
IntActiP59103, 1 interactor
MINTiP59103
STRINGi9606.ENSP00000483757

Genetic variation databases

BioMutaiDAOA
DMDMi84028201

Proteomic databases

PaxDbiP59103
PRIDEiP59103
ProteomicsDBi57133 [P59103-1]
57134 [P59103-2]
70872

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
54191, 79 antibodies

Genome annotation databases

EnsembliENST00000329625; ENSP00000329951; ENSG00000182346 [P59103-3]
ENST00000375936; ENSP00000365103; ENSG00000182346 [P59103-1]
ENST00000473269; ENSP00000470244; ENSG00000182346 [P59103-4]
ENST00000559369; ENSP00000453831; ENSG00000182346 [P59103-3]
ENST00000600388; ENSP00000472260; ENSG00000182346 [P59103-3]
ENST00000618629; ENSP00000483757; ENSG00000182346 [P59103-1]
GeneIDi267012
KEGGihsa:267012
UCSCiuc001vqb.5, human [P59103-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
267012
DisGeNETi267012

GeneCards: human genes, protein and diseases

More...
GeneCardsi
DAOA
HGNCiHGNC:21191, DAOA
HPAiENSG00000182346, Not detected
MalaCardsiDAOA
MIMi181500, phenotype
607408, gene
neXtProtiNX_P59103
OpenTargetsiENSG00000182346
PharmGKBiPA134924986
VEuPathDBiHostDB:ENSG00000182346.17

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502T4XP, Eukaryota
GeneTreeiENSGT00410000028557
HOGENOMiCLU_2557651_0_0_1
InParanoidiP59103
OMAiTSTKAEW
OrthoDBi1378516at2759
PhylomeDBiP59103
TreeFamiTF354179

Enzyme and pathway databases

PathwayCommonsiP59103

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
267012, 6 hits in 983 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
267012
PharosiP59103, Tbio

Protein Ontology

More...
PROi
PR:P59103
RNActiP59103, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000182346, Expressed in muscle tissue and 16 other tissues
ExpressionAtlasiP59103, baseline and differential
GenevisibleiP59103, HS

Family and domain databases

InterProiView protein in InterPro
IPR027929, DAOA
PfamiView protein in Pfam
PF15199, DAOA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDAOA_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P59103
Secondary accession number(s): A6NKG7
, Q0VAE6, Q5VX59, Q86Y17, Q8IWM4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 25, 2002
Last sequence update: December 20, 2005
Last modified: April 7, 2021
This is version 133 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again