Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NACHT, LRR and PYD domains-containing protein 12

Gene

NLRP12

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May mediate activation of CASP1 via ASC and promote activation of NF-kappa-B via IKK.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi217 – 224ATP8

GO - Molecular functioni

GO - Biological processi

Keywordsi

LigandATP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
NACHT, LRR and PYD domains-containing protein 12
Alternative name(s):
Monarch-1
PYRIN-containing APAF1-like protein 7
Regulated by nitric oxide
Gene namesi
Name:NLRP12
Synonyms:NALP12, PYPAF7, RNO
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000142405.21
HGNCiHGNC:22938 NLRP12
MIMi609648 gene
neXtProtiNX_P59046

Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Involvement in diseasei

Familial cold autoinflammatory syndrome 2 (FCAS2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA rare autosomal dominant systemic inflammatory disease characterized by recurrent episodes of maculopapular rash associated with arthralgias, myalgias, fever and chills, swelling of the extremities, and conjunctivitis after generalized exposure to cold.
See also OMIM:611762

Organism-specific databases

DisGeNETi91662
MalaCardsiNLRP12
MIMi611762 phenotype
OpenTargetsiENSG00000142405
Orphaneti247868 NLRP12-associated hereditary periodic fever syndrome
PharmGKBiPA162397866

Polymorphism and mutation databases

DMDMi34223733

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000808991 – 1061NACHT, LRR and PYD domains-containing protein 12Add BLAST1061

Proteomic databases

PaxDbiP59046
PeptideAtlasiP59046
PRIDEiP59046
ProteomicsDBi57117
57118 [P59046-2]
57119 [P59046-3]
57120 [P59046-4]
57121 [P59046-5]

PTM databases

iPTMnetiP59046
PhosphoSitePlusiP59046

Expressioni

Tissue specificityi

Detected only in peripheral blood leukocytes, predominantly in eosinophils and granulocytes, and at lower levels in monocytes.1 Publication

Inductioni

By nitric oxide and DMSO in HL-60 cells, an acute myeloid leukemia cell line.1 Publication

Gene expression databases

BgeeiENSG00000142405 Expressed in 61 organ(s), highest expression level in blood
CleanExiHS_NLRP12
ExpressionAtlasiP59046 baseline and differential
GenevisibleiP59046 HS

Organism-specific databases

HPAiHPA042981

Interactioni

Subunit structurei

Binds to ASC with its pyrin domain. Interacts with FAF1 UBA domain via its pyrin domain.1 Publication

Protein-protein interaction databases

BioGridi124861, 5 interactors
IntActiP59046, 24 interactors
MINTiP59046
STRINGi9606.ENSP00000319377

Structurei

Secondary structure

11061
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP59046
SMRiP59046
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP59046

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 95PyrinPROSITE-ProRule annotationAdd BLAST95
Domaini211 – 528NACHTPROSITE-ProRule annotationAdd BLAST318
Repeati828 – 848LRR 1Add BLAST21
Repeati857 – 878LRR 2Add BLAST22
Repeati885 – 906LRR 3Add BLAST22
Repeati914 – 935LRR 4Add BLAST22
Repeati942 – 962LRR 5Add BLAST21
Repeati971 – 992LRR 6Add BLAST22
Repeati999 – 1020LRR 7Add BLAST22
Repeati1028 – 1049LRR 8Add BLAST22

Sequence similaritiesi

Belongs to the NLRP family.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

eggNOGiENOG410IE5X Eukaryota
ENOG4111H3D LUCA
GeneTreeiENSGT00900000140813
HOGENOMiHOG000294064
HOVERGENiHBG063656
InParanoidiP59046
KOiK20865
OMAiLCRLSAY
OrthoDBiEOG091G01CG
PhylomeDBiP59046
TreeFamiTF340267

Family and domain databases

Gene3Di3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR004020 DAPIN
IPR011029 DEATH-like_dom_sf
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR029495 NACHT-assoc
IPR007111 NACHT_NTPase
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF14484 FISNA, 1 hit
PF13516 LRR_6, 5 hits
PF05729 NACHT, 1 hit
PF02758 PYRIN, 1 hit
SMARTiView protein in SMART
SM01288 FISNA, 1 hit
SM01289 PYRIN, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50824 DAPIN, 1 hit
PS51450 LRR, 5 hits
PS50837 NACHT, 1 hit

Sequences (7+)i

Sequence statusi: Complete.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 7 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P59046-1) [UniParc]FASTAAdd to basket
Also known as: I

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLRTAGRDGL CRLSTYLEEL EAVELKKFKL YLGTATELGE GKIPWGSMEK
60 70 80 90 100
AGPLEMAQLL ITHFGPEEAW RLALSTFERI NRKDLWERGQ REDLVRDTPP
110 120 130 140 150
GGPSSLGNQS TCLLEVSLVT PRKDPQETYR DYVRRKFRLM EDRNARLGEC
160 170 180 190 200
VNLSHRYTRL LLVKEHSNPM QVQQQLLDTG RGHARTVGHQ ASPIKIETLF
210 220 230 240 250
EPDEERPEPP RTVVMQGAAG IGKSMLAHKV MLDWADGKLF QGRFDYLFYI
260 270 280 290 300
NCREMNQSAT ECSMQDLIFS CWPEPSAPLQ ELIRVPERLL FIIDGFDELK
310 320 330 340 350
PSFHDPQGPW CLCWEEKRPT ELLLNSLIRK KLLPELSLLI TTRPTALEKL
360 370 380 390 400
HRLLEHPRHV EILGFSEAER KEYFYKYFHN AEQAGQVFNY VRDNEPLFTM
410 420 430 440 450
CFVPLVCWVV CTCLQQQLEG GGLLRQTSRT TTAVYMLYLL SLMQPKPGAP
460 470 480 490 500
RLQPPPNQRG LCSLAADGLW NQKILFEEQD LRKHGLDGED VSAFLNMNIF
510 520 530 540 550
QKDINCERYY SFIHLSFQEF FAAMYYILDE GEGGAGPDQD VTRLLTEYAF
560 570 580 590 600
SERSFLALTS RFLFGLLNEE TRSHLEKSLC WKVSPHIKMD LLQWIQSKAQ
610 620 630 640 650
SDGSTLQQGS LEFFSCLYEI QEEEFIQQAL SHFQVIVVSN IASKMEHMVS
660 670 680 690 700
SFCLKRCRSA QVLHLYGATY SADGEDRARC SAGAHTLLVQ LPERTVLLDA
710 720 730 740 750
YSEHLAAALC TNPNLIELSL YRNALGSRGV KLLCQGLRHP NCKLQNLRLK
760 770 780 790 800
RCRISSSACE DLSAALIANK NLTRMDLSGN GVGFPGMMLL CEGLRHPQCR
810 820 830 840 850
LQMIQLRKCQ LESGACQEMA SVLGTNPHLV ELDLTGNALE DLGLRLLCQG
860 870 880 890 900
LRHPVCRLRT LWLKICRLTA AACDELASTL SVNQSLRELD LSLNELGDLG
910 920 930 940 950
VLLLCEGLRH PTCKLQTLRL GICRLGSAAC EGLSVVLQAN HNLRELDLSF
960 970 980 990 1000
NDLGDWGLWL LAEGLQHPAC RLQKLWLDSC GLTAKACENL YFTLGINQTL
1010 1020 1030 1040 1050
TDLYLTNNAL GDTGVRLLCK RLSHPGCKLR VLWLFGMDLN KMTHSRLAAL
1060
RVTKPYLDIG C
Length:1,061
Mass (Da):120,173
Last modified:August 22, 2003 - v2
Checksum:i8C10AFE4907C131B
GO
Isoform 2 (identifier: P59046-2) [UniParc]FASTAAdd to basket
Also known as: II

The sequence of this isoform differs from the canonical sequence as follows:
     976-1031: Missing.

Show »
Length:1,005
Mass (Da):114,006
Checksum:i79BD8925AA43644F
GO
Isoform 3 (identifier: P59046-3) [UniParc]FASTAAdd to basket
Also known as: III

The sequence of this isoform differs from the canonical sequence as follows:
     862-973: Missing.

Show »
Length:949
Mass (Da):107,913
Checksum:i99995A1C7261D636
GO
Isoform 4 (identifier: P59046-4) [UniParc]FASTAAdd to basket
Also known as: IV

The sequence of this isoform differs from the canonical sequence as follows:
     862-1031: Missing.

Show »
Length:891
Mass (Da):101,504
Checksum:i43093A9B22873A00
GO
Isoform 5 (identifier: P59046-5) [UniParc]FASTAAdd to basket
Also known as: rno-2

The sequence of this isoform differs from the canonical sequence as follows:
     1-717: Missing.
     718-748: LSLYRNALGSRGVKLLCQGLRHPNCKLQNLR → MSQAWWHTSVSPATQEAKAGGLLQPRRQRLW
     921-977: Missing.

Show »
Length:287
Mass (Da):31,765
Checksum:iBD3816C3255B2F9E
GO
Isoform 6 (identifier: P59046-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     920-976: Missing.

Note: No experimental confirmation available.
Show »
Length:1,004
Mass (Da):113,876
Checksum:i7D7350A83F286749
GO
Isoform 7 (identifier: P59046-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     691-691: L → LR

Note: No experimental confirmation.
Show »
Length:1,062
Mass (Da):120,329
Checksum:i0AB81C87F116497F
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0C4DFY3A0A0C4DFY3_HUMAN
NACHT, LRR and PYD domains-containi...
NLRP12
892Annotation score:
A0A0C4DH17A0A0C4DH17_HUMAN
NACHT, LRR and PYD domains-containi...
NLRP12
1,006Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti648M → T in BAG53059 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05362039G → V. Corresponds to variant dbSNP:rs34436714EnsemblClinVar.1
Natural variantiVAR_053621402F → L. Corresponds to variant dbSNP:rs34971363EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0169081 – 717Missing in isoform 5. 1 PublicationAdd BLAST717
Alternative sequenceiVSP_055193691L → LR in isoform 7. 1 Publication1
Alternative sequenceiVSP_016909718 – 748LSLYR…LQNLR → MSQAWWHTSVSPATQEAKAG GLLQPRRQRLW in isoform 5. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_009879862 – 1031Missing in isoform 4. 1 PublicationAdd BLAST170
Alternative sequenceiVSP_005523862 – 973Missing in isoform 3. 1 PublicationAdd BLAST112
Alternative sequenceiVSP_054622920 – 976Missing in isoform 6. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_016910921 – 977Missing in isoform 5. 1 PublicationAdd BLAST57
Alternative sequenceiVSP_005524976 – 1031Missing in isoform 2. 1 PublicationAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY095146 mRNA Translation: AAM18227.1
AY154467 mRNA Translation: AAO18163.1
AY116204 mRNA Translation: AAM75142.1
AY116205 mRNA Translation: AAM75143.1
AY116206 mRNA Translation: AAM75144.1
AY116207 mRNA Translation: AAM75145.1
AF231021 mRNA Translation: AAK14942.1
AK095460 mRNA Translation: BAG53059.1
AC008753 Genomic DNA No translation available.
CH471135 Genomic DNA Translation: EAW72152.1
BC028069 mRNA Translation: AAH28069.1
CCDSiCCDS12864.1 [P59046-1]
CCDS62784.1 [P59046-6]
CCDS62785.1 [P59046-7]
RefSeqiNP_001264055.1, NM_001277126.1 [P59046-7]
NP_001264058.1, NM_001277129.1 [P59046-6]
NP_653288.1, NM_144687.3 [P59046-1]
UniGeneiHs.631573

Genome annotation databases

EnsembliENST00000324134; ENSP00000319377; ENSG00000142405 [P59046-1]
ENST00000391773; ENSP00000375653; ENSG00000142405 [P59046-7]
ENST00000391775; ENSP00000375655; ENSG00000142405 [P59046-6]
GeneIDi91662
KEGGihsa:91662
UCSCiuc002qch.6 human [P59046-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY095146 mRNA Translation: AAM18227.1
AY154467 mRNA Translation: AAO18163.1
AY116204 mRNA Translation: AAM75142.1
AY116205 mRNA Translation: AAM75143.1
AY116206 mRNA Translation: AAM75144.1
AY116207 mRNA Translation: AAM75145.1
AF231021 mRNA Translation: AAK14942.1
AK095460 mRNA Translation: BAG53059.1
AC008753 Genomic DNA No translation available.
CH471135 Genomic DNA Translation: EAW72152.1
BC028069 mRNA Translation: AAH28069.1
CCDSiCCDS12864.1 [P59046-1]
CCDS62784.1 [P59046-6]
CCDS62785.1 [P59046-7]
RefSeqiNP_001264055.1, NM_001277126.1 [P59046-7]
NP_001264058.1, NM_001277129.1 [P59046-6]
NP_653288.1, NM_144687.3 [P59046-1]
UniGeneiHs.631573

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2L6ANMR-A1-98[»]
4XHSX-ray1.70A/B10-106[»]
5H7NX-ray1.85A/B9-106[»]
ProteinModelPortaliP59046
SMRiP59046
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124861, 5 interactors
IntActiP59046, 24 interactors
MINTiP59046
STRINGi9606.ENSP00000319377

PTM databases

iPTMnetiP59046
PhosphoSitePlusiP59046

Polymorphism and mutation databases

DMDMi34223733

Proteomic databases

PaxDbiP59046
PeptideAtlasiP59046
PRIDEiP59046
ProteomicsDBi57117
57118 [P59046-2]
57119 [P59046-3]
57120 [P59046-4]
57121 [P59046-5]

Protocols and materials databases

DNASUi91662
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000324134; ENSP00000319377; ENSG00000142405 [P59046-1]
ENST00000391773; ENSP00000375653; ENSG00000142405 [P59046-7]
ENST00000391775; ENSP00000375655; ENSG00000142405 [P59046-6]
GeneIDi91662
KEGGihsa:91662
UCSCiuc002qch.6 human [P59046-1]

Organism-specific databases

CTDi91662
DisGeNETi91662
EuPathDBiHostDB:ENSG00000142405.21
GeneCardsiNLRP12
HGNCiHGNC:22938 NLRP12
HPAiHPA042981
MalaCardsiNLRP12
MIMi609648 gene
611762 phenotype
neXtProtiNX_P59046
OpenTargetsiENSG00000142405
Orphaneti247868 NLRP12-associated hereditary periodic fever syndrome
PharmGKBiPA162397866
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IE5X Eukaryota
ENOG4111H3D LUCA
GeneTreeiENSGT00900000140813
HOGENOMiHOG000294064
HOVERGENiHBG063656
InParanoidiP59046
KOiK20865
OMAiLCRLSAY
OrthoDBiEOG091G01CG
PhylomeDBiP59046
TreeFamiTF340267

Miscellaneous databases

EvolutionaryTraceiP59046
GeneWikiiNLRP12
GenomeRNAii91662
PROiPR:P59046
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000142405 Expressed in 61 organ(s), highest expression level in blood
CleanExiHS_NLRP12
ExpressionAtlasiP59046 baseline and differential
GenevisibleiP59046 HS

Family and domain databases

Gene3Di3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR004020 DAPIN
IPR011029 DEATH-like_dom_sf
IPR001611 Leu-rich_rpt
IPR032675 LRR_dom_sf
IPR029495 NACHT-assoc
IPR007111 NACHT_NTPase
IPR027417 P-loop_NTPase
PfamiView protein in Pfam
PF14484 FISNA, 1 hit
PF13516 LRR_6, 5 hits
PF05729 NACHT, 1 hit
PF02758 PYRIN, 1 hit
SMARTiView protein in SMART
SM01288 FISNA, 1 hit
SM01289 PYRIN, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50824 DAPIN, 1 hit
PS51450 LRR, 5 hits
PS50837 NACHT, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNAL12_HUMAN
AccessioniPrimary (citable) accession number: P59046
Secondary accession number(s): A8MTQ2
, B3KTE7, Q8NEU4, Q9BY26
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: August 22, 2003
Last modified: November 7, 2018
This is version 158 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again