UniProtKB - P58811 (CA1A_CONTU)
(max 400 entries)x
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST
>sp|P58811|CA1A_CONTU Rho-conotoxin TIA OS=Conus tulipa OX=6495 PE=1 SV=2 MFTVFLLVVLATTGVSFTLDRASDGGNAVAKKSDVTARFNWRCCLIPACRRNHKKFCG
- Align
- Format
- Add to basketAdded to basket
- History
- Other tutorials and videos
- Help video
- Feedback
Protein
Rho-conotoxin TIA
Gene
N/A
Organism
Conus tulipa (Fish-hunting cone snail) (Tulip cone)
Status
Reviewed-Annotation score:
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
Allosteric inhibitor of alpha-1B adrenergic receptors (ADRA1B). Binds to an allosteric modulatory site on transmembrane helix 6 and 7 at the base of extracellular loop 3 of ADRA1B (PubMed:23184947). Also weekly inhibits alpha-1A (ADRA1A) and alpha-1D (ADRA1D) adrenergic receptors in a competive manner (PubMed:15194691). Potently inhibits contractions of vas deferens, spleen and aorta in response to noradrenaline (PubMed:15680270).5 Publications
<p>Manually curated information for which there is published experimental evidence.</p> <p><a href="/manual/evidences#ECO:0000269">More...</a></p> Manual assertion based on experiment ini
- Ref.2"Two new classes of conopeptides inhibit the alpha1-adrenoceptor and noradrenaline transporter."
Sharpe I.A., Gehrmann J., Loughnan M.L., Thomas L., Adams D.A., Atkins A., Palant E., Craik D.J., Adams D.J., Alewood P.F., Lewis R.J.
Nat. Neurosci. 4:902-907(2001) [PubMed] [Europe PMC] [Abstract] - Ref.3"Allosteric alpha 1-adrenoreceptor antagonism by the conopeptide rho-TIA."
Sharpe I.A., Thomas L., Loughnan M.L., Motin L., Palant E., Croker D.E., Alewood D., Chen S., Graham R.M., Alewood P.F., Adams D.J., Lewis R.J.
J. Biol. Chem. 278:34451-34457(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SYNTHESIS OF 39-57, MUTAGENESIS OF ASN-40; TRP-41; ARG-42; LEU-45; ILE-46 AND ARG-50. - Ref.4"Subtype-selective noncompetitive or competitive inhibition of human alpha1-adrenergic receptors by rho-TIA."
Chen Z., Rogge G., Hague C., Alewood D., Colless B., Lewis R.J., Minneman K.P.
J. Biol. Chem. 279:35326-35333(2004) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, MUTAGENESIS OF ILE-46 AND PHE-56. - Ref.5"Differential antagonism by conotoxin rho-TIA of contractions mediated by distinct alpha1-adrenoceptor subtypes in rat vas deferens, spleen and aorta."
Lima V., Mueller A., Kamikihara S.Y., Raymundi V., Alewood D., Lewis R.J., Chen Z., Minneman K.P., Pupo A.S.
Eur. J. Pharmacol. 508:183-192(2005) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION. - Ref.6"Conopeptide rho-TIA defines a new allosteric site on the extracellular surface of the alpha1B-adrenoceptor."
Ragnarsson L., Wang C.I., Andersson A., Fajarningsih D., Monks T., Brust A., Rosengren K.J., Lewis R.J.
J. Biol. Chem. 288:1814-1827(2013) [PubMed] [Europe PMC] [Abstract]
Miscellaneous
Has no effect on alpha-2 adrenergic receptors (ADRA2) (PubMed:11528421, PubMed:12824165).2 Publications
<p>Manually curated information which has been inferred by a curator based on his/her scientific knowledge or on the scientific content of an article.</p> <p><a href="/manual/evidences#ECO:0000305">More...</a></p> Manual assertion inferred by curator fromi
- Ref.2"Two new classes of conopeptides inhibit the alpha1-adrenoceptor and noradrenaline transporter."
Sharpe I.A., Gehrmann J., Loughnan M.L., Thomas L., Adams D.A., Atkins A., Palant E., Craik D.J., Adams D.J., Alewood P.F., Lewis R.J.
Nat. Neurosci. 4:902-907(2001) [PubMed] [Europe PMC] [Abstract] - Ref.3"Allosteric alpha 1-adrenoreceptor antagonism by the conopeptide rho-TIA."
Sharpe I.A., Thomas L., Loughnan M.L., Motin L., Palant E., Croker D.E., Alewood D., Chen S., Graham R.M., Alewood P.F., Adams D.J., Lewis R.J.
J. Biol. Chem. 278:34451-34457(2003) [PubMed] [Europe PMC] [Abstract]Cited for: FUNCTION, SYNTHESIS OF 39-57, MUTAGENESIS OF ASN-40; TRP-41; ARG-42; LEU-45; ILE-46 AND ARG-50.
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- acetylcholine receptor inhibitor activity Source: InterPro
- toxin activity Source: UniProtKB-KW
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Molecular function | G-protein coupled receptor impairing toxin, Toxin |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: Rho-conotoxin TIA1 Publication<p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
Short name: Rho-TIA1 Publication Manual assertion based on opinion ini
|
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Conus tulipa (Fish-hunting cone snail) (Tulip cone) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 6495 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Protostomia › Lophotrochozoa › Mollusca › Gastropoda › Caenogastropoda › Neogastropoda › Conoidea › Conidae › Conus › Gastridium |
Organism-specific databases
ConoServer: Cone snail toxin database More...ConoServeri | 1634 TIA |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Extracellular region or secreted
- Secreted 1 Publication
Manual assertion based on experiment ini
- Ref.2"Two new classes of conopeptides inhibit the alpha1-adrenoceptor and noradrenaline transporter."
Sharpe I.A., Gehrmann J., Loughnan M.L., Thomas L., Adams D.A., Atkins A., Palant E., Craik D.J., Adams D.J., Alewood P.F., Lewis R.J.
Nat. Neurosci. 4:902-907(2001) [PubMed] [Europe PMC] [Abstract]
- Secreted 1 Publication
Extracellular region or secreted
- extracellular region Source: UniProtKB-SubCell
Keywords - Cellular componenti
Secreted<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
Mutagenesis
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi | 40 | N → A: Little loss in inhibition. 1 Publication Manual assertion based on experiment ini
| 1 | |
| Mutagenesisi | 41 | W → A: Important loss in inhibition. 1 Publication Manual assertion based on experiment ini
| 1 | |
| Mutagenesisi | 42 | R → A: Most important loss in inhibition. 1 Publication Manual assertion based on experiment ini
| 1 | |
| Mutagenesisi | 45 | L → A: Little loss in inhibition. 1 Publication Manual assertion based on experiment ini
| 1 | |
| Mutagenesisi | 46 | I → A: Important loss in inhibition, and change from non-competitive to competitive antagonist of alpha-1B receptor subtype. 2 Publications Manual assertion based on experiment ini
| 1 | |
| Mutagenesisi | 50 | R → A: Little loss in inhibition. 1 Publication Manual assertion based on experiment ini
| 1 | |
| Mutagenesisi | 56 | F → A or N: Selectivity increase for alpha-1B subtype. 1 Publication Manual assertion based on experiment ini
| 1 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei | 1 – 16 | Sequence analysisAdd BLAST | 16 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000404204 | 17 – 38 | 1 Publication Manual assertion based on experiment ini
| 22 | |
| <p>This subsection of the ‘PTM / Processing’ section describes the position and length of an active peptide in the mature protein.<p><a href='/help/peptide' target='_top'>More...</a></p>PeptideiPRO_0000044510 | 39 – 57 | Rho-conotoxin TIA1 Publication Manual assertion based on experiment ini
| 19 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi | 43 ↔ 49 | 2 Publications Manual assertion based on experiment ini
<p>Manually validated information which has been imported from another database.</p> <p><a href="/manual/evidences#ECO:0000312">More...</a></p> Manual assertion inferred from database entriesi | ||
| Disulfide bondi | 44 ↔ 57 | 2 Publications Manual assertion based on experiment ini
Manual assertion inferred from database entriesi | ||
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 57 | Cysteine amide1 Publication Manual assertion based on experiment ini
| 1 |
Keywords - PTMi
Amidation, Disulfide bond<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
Expressed by the venom duct.1 Publication
Manual assertion inferred by curator fromi
- Ref.2"Two new classes of conopeptides inhibit the alpha1-adrenoceptor and noradrenaline transporter."
Sharpe I.A., Gehrmann J., Loughnan M.L., Thomas L., Adams D.A., Atkins A., Palant E., Craik D.J., Adams D.J., Alewood P.F., Lewis R.J.
Nat. Neurosci. 4:902-907(2001) [PubMed] [Europe PMC] [Abstract]
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
Secondary structure
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more detailsHide details| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 42 – 45 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| Helixi | 47 – 50 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| Helixi | 54 – 56 | Combined sources Manual assertion inferred from combination of experimental and computational evidencei | 3 |
3D structure databases
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P58811 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Miscellaneous databases
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P58811 |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Region
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni | 40 – 42 | Interaction with ADRA1B | 3 |
<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini
The cysteine framework is I (CC-C-C). Alpha4/7 pattern.Curated
<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi
Belongs to the conotoxin A superfamily.Curated
Keywords - Domaini
SignalFamily and domain databases
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR009958 Conotoxin_a-typ |
Pfam protein domain database More...Pfami | View protein in Pfam PF07365 Toxin_8, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequencei
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.
P58811-1 [UniParc]FASTAAdd to basketAdded to basket
« Hide
Show »10 20 30 40 50
MFTVFLLVVL ATTGVSFTLD RASDGGNAVA KKSDVTARFN WRCCLIPACR
RNHKKFCG
Length:58
Mass (Da):6,395
Last modified:February 8, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:iEAA3234432D865A6
<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni
The sequence ADN79119 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
<p>This subsection of the ‘Sequence’ section reports information derived from mass spectrometry experiments done on the entire protein or on biologically active derived peptide(s).<p><a href='/help/mass_spectrometry' target='_top'>More...</a></p>Mass spectrometryi
Molecular mass is 2390.15 Da from positions 39 - 57. Determined by ESI. 1 Publication
Manual assertion based on experiment ini
- Ref.2"Two new classes of conopeptides inhibit the alpha1-adrenoceptor and noradrenaline transporter."
Sharpe I.A., Gehrmann J., Loughnan M.L., Thomas L., Adams D.A., Atkins A., Palant E., Craik D.J., Adams D.J., Alewood P.F., Lewis R.J.
Nat. Neurosci. 4:902-907(2001) [PubMed] [Europe PMC] [Abstract]
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | GQ981400 mRNA Translation: ADN79119.1 Different initiation. |
<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | Source | |
|---|---|---|---|---|---|---|
| P58811 | Alpha-conotoxin-like Bn1.3 | 62 | UniRef50_P58811 | |||
| Alpha-conotoxin-like ImIIA | 62 | |||||
| Alpha-conotoxin-like Qc1.2 | 62 | |||||
| Alpha-conotoxin-like Lp1.7 | 64 | |||||
| Alpha-conotoxin-like Lt1.3 | 64 | |||||
| +98 | ||||||
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | CA1A_CONTU | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | P58811Primary (citable) accession number: P58811 Secondary accession number(s): E2DEK8 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | May 2, 2002 |
| Last sequence update: | February 8, 2011 | |
| Last modified: | September 12, 2018 | |
| This is version 63 of the entry and version 2 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Animal Toxin Annotation Program | |
