TIRAP

Functionⁱ

Adapter involved in TLR2 and TLR4 signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response. Positively regulates the production of TNF-alpha and interleukin-6.2 Publications

Caution

Variant Leu-180 has been reported to reduce TLR2 signal transduction (PubMed:17322885). In contrast, PubMed:19509286 reports that this variant is fully active and has no effect on signal transduction pathways and cytokine production.1 Publication

GO - Molecular functionⁱ

identical protein binding
Source: IntAct
Inferred from physical interactionⁱ
- 17258210
- 24275656
phosphatidylinositol-4,5-bisphosphate binding Source: BHF-UCL
protein binding, bridging
Source: BHF-UCL
Non-traceable author statementⁱ
- 19509286
protein heterodimerization activity
Source: BHF-UCL
Inferred from direct assayⁱ
- 19509286
protein homodimerization activity Source: BHF-UCL
protein kinase C binding
Source: BHF-UCL
Inferred from physical interactionⁱ
- 17161867
Toll-like receptor 2 binding
Source: BHF-UCL
Inferred from physical interactionⁱ
- 19509286
Toll-like receptor 4 binding
Source: BHF-UCL
Inferred from physical interactionⁱ
- 19509286

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

3'-UTR-mediated mRNA stabilization
Source: BHF-UCL
Inferred from direct assayⁱ
- 15294994
activation of NF-kappaB-inducing kinase activity
Source: AgBase
Inferred from mutant phenotypeⁱ
- 24275656
cell surface receptor signaling pathway Source: BHF-UCL
cellular response to bacterial lipopeptide Source: BHF-UCL
cellular response to lipoteichoic acid Source: BHF-UCL
defense response to Gram-positive bacterium Source: BHF-UCL
inflammatory response Source: UniProtKB-KW
innate immune response Source: UniProtKB-KW
MyD88-dependent toll-like receptor signaling pathway
Source: BHF-UCL
Traceable author statementⁱ
- 19509286
myeloid cell differentiation Source: BHF-UCL
negative regulation of growth of symbiont in host Source: BHF-UCL
positive regulation of B cell proliferation Source: BHF-UCL
positive regulation of chemokine (C-X-C motif) ligand 1 production Source: BHF-UCL
positive regulation of chemokine (C-X-C motif) ligand 2 production Source: BHF-UCL
positive regulation of ERK1 and ERK2 cascade
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 11544529
positive regulation of I-kappaB kinase/NF-kappaB signaling
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 19509286
positive regulation of interleukin-12 production Source: BHF-UCL
positive regulation of interleukin-15 production
Source: BHF-UCL
Inferred from direct assayⁱ
- 18583567
positive regulation of interleukin-6 biosynthetic process
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 16301656
positive regulation of interleukin-8 production
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 16301656
positive regulation of JNK cascade
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 11544529
positive regulation of neutrophil chemotaxis Source: BHF-UCL
positive regulation of NF-kappaB transcription factor activity
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 19509286
positive regulation of protein homodimerization activity
Source: BHF-UCL
Inferred from direct assayⁱ
- 12062447
positive regulation of toll-like receptor 2 signaling pathway
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 19509286
positive regulation of toll-like receptor 3 signaling pathway Source: BHF-UCL
positive regulation of toll-like receptor 4 signaling pathway
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 19509286
positive regulation of tumor necrosis factor production
Source: BHF-UCL
Inferred from mutant phenotypeⁱ
- 16301656
- 19509286
regulation of innate immune response
Source: BHF-UCL
Inferred by curatorⁱ
- 19509286
regulation of interferon-beta production Source: BHF-UCL
response to lipopolysaccharide
Source: BHF-UCL
Inferred from direct assayⁱ
- 11544529
TIRAP-dependent toll-like receptor 4 signaling pathway
Source: BHF-UCL
Inferred from direct assayⁱ
- 11544529

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Immunity, Inflammatory response, Innate immunity

Biological process

Immunity, Inflammatory response, Innate immunity

Enzyme and pathway databases

Reactomeⁱ	R-HSA-1236974 ER-Phagosome pathway R-HSA-166058 MyD88:MAL(TIRAP) cascade initiated on plasma membrane R-HSA-5602498 MyD88 deficiency (TLR2/4) R-HSA-5603041 IRAK4 deficiency (TLR2/4)
SignaLinkⁱ	P58753
SIGNORⁱ	P58753

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Toll/interleukin-1 receptor domain-containing adapter protein Short name: TIR domain-containing adapter protein Alternative name(s): Adaptor protein Wyatt MyD88 adapter-like protein Short name: MyD88-2
Gene namesⁱ	Name:TIRAP Synonyms:MAL
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 11

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000150455.13
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:17192 TIRAP
MIMⁱ	606252 gene
neXtProtⁱ	NX_P58753

Keywords - Cellular componentⁱ

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Mutagenesisⁱ	125	P → H: Abolishes NF-kappa-B activation. 2 Publications		1

Organism-specific databases

DisGeNET More...DisGeNETⁱ	114609
MalaCards human disease database More...MalaCardsⁱ	TIRAP
MIMⁱ	607948 phenotype 610799 phenotype 611162 phenotype 614382 phenotype
Open Targets More...OpenTargetsⁱ	ENSG00000150455
PharmGKBⁱ	PA134972842

Polymorphism and mutation databases

BioMutaⁱ	TIRAP
DMDMⁱ	50403750

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000072547	1 – 221	Toll/interleukin-1 receptor domain-containing adapter proteinAdd BLAST		221

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Disulfide bondⁱ	89 ↔ 134	1 Publication
Disulfide bondⁱ	142 ↔ 174	1 Publication

Post-translational modificationⁱ

Phosphorylated by IRAK1 and IRAK4. Also phosphorylated by BTK.

Polyubiquitinated. Polyubiquitination follows phosphorylation by BTK and leads to TIRAP degradation.1 Publication

Keywords - PTMⁱ

Disulfide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOSTⁱ	P58753
PaxDbⁱ	P58753
PeptideAtlas More...PeptideAtlasⁱ	P58753
PRIDEⁱ	P58753
ProteomicsDBⁱ	57101 57102 [P58753-2] 57103 [P58753-3]

PTM databases

iPTMnetⁱ	P58753
PhosphoSitePlusⁱ	P58753

Expressionⁱ

Tissue specificityⁱ

Highly expressed in liver, kidney, spleen, skeletal muscle and heart. Also detected in peripheral blood leukocytes, lung, placenta, small intestine, thymus, colon and brain.

Gene expression databases

Bgeeⁱ	ENSG00000150455 Expressed in 117 organ(s), highest expression level in leukocyte
CleanExⁱ	HS_MAL HS_TIRAP
ExpressionAtlasⁱ	P58753 baseline and differential
Genevisibleⁱ	P58753 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA054431

HPAⁱ

HPA054431

Interactionⁱ

Subunit structureⁱ

Homodimer. Also forms heterodimers with MYD88. May interact with PIK3AP1 (By similarity). Interacts with TLR4 and IRAK2 via their respective TIR domains. Interacts with BMX and TBK1. Interacts with EIF2AK2. Does not interact with IRAK1, nor TLR9.By similarity6 Publications

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
itself		2	EBI-528644,EBI-528644
AGER	Q15109	9	EBI-528644,EBI-1646426
ARAF	P10398	2	EBI-528644,EBI-365961
CASP1	P29466	5	EBI-528654,EBI-516667
CCDC47	Q96A33	2	EBI-528644,EBI-720151
IRAK1	P51617	2	EBI-528644,EBI-358664
IRAK2	O43187	2	EBI-528644,EBI-447733
IRAK4	Q9NWZ3	2	EBI-528644,EBI-448378
LTN1	O94822	2	EBI-528644,EBI-1044684
MYD88	Q99836	8	EBI-528644,EBI-447677
PIK3R1	P27986	3	EBI-528644,EBI-79464
SAMHD1	Q9Y3Z3	2	EBI-528644,EBI-1054601
TLR4	O00206	6	EBI-528644,EBI-528701

GO - Molecular functionⁱ

identical protein binding
Source: IntAct
Inferred from physical interactionⁱ
- 17258210
- 24275656
protein binding, bridging
Source: BHF-UCL
Non-traceable author statementⁱ
- 19509286
protein heterodimerization activity
Source: BHF-UCL
Inferred from direct assayⁱ
- 19509286
protein homodimerization activity Source: BHF-UCL
protein kinase C binding
Source: BHF-UCL
Inferred from physical interactionⁱ
- 17161867
Toll-like receptor 2 binding
Source: BHF-UCL
Inferred from physical interactionⁱ
- 19509286
Toll-like receptor 4 binding
Source: BHF-UCL
Inferred from physical interactionⁱ
- 19509286

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	125325, 41 interactors
Database of interacting proteins More...DIPⁱ	DIP-33489N
IntActⁱ	P58753, 38 interactors
Molecular INTeraction database More...MINTⁱ	P58753
STRINGⁱ	9606.ENSP00000376445

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Helixⁱ	17 – 28	Combined sources	12
Beta strandⁱ	83 – 91	Combined sources	9
Helixⁱ	94 – 96	Combined sources	3
Helixⁱ	97 – 108	Combined sources	12
Turnⁱ	109 – 111	Combined sources	3
Beta strandⁱ	131 – 133	Combined sources	3
Helixⁱ	135 – 139	Combined sources	5
Beta strandⁱ	140 – 147	Combined sources	8
Helixⁱ	149 – 153	Combined sources	5
Helixⁱ	155 – 166	Combined sources	12
Beta strandⁱ	168 – 179	Combined sources	12
Helixⁱ	184 – 186	Combined sources	3
Helixⁱ	189 – 193	Combined sources	5
Helixⁱ	202 – 205	Combined sources	4
Helixⁱ	206 – 217	Combined sources	12

Show more details

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2NDH	NMR	-	A	79-221	[»]
	2Y92	X-ray	3.01	A	79-221	[»]
	3UB2	X-ray	2.40	A	78-221	[»]
	3UB3	X-ray	2.75	A	78-221	[»]
	3UB4	X-ray	3.10	A	78-221	[»]
	4FZ5	X-ray	3.60	A/B	72-221	[»]
	4LQD	X-ray	2.45	A	81-221	[»]
	5T7Q	NMR	-	A	15-35	[»]
	5UZB	electron microscopy	7.00	A/B/C/D/E/F/G/H/I/J/K/L/M/N	79-221	[»]
ProteinModelPortalⁱ	P58753
SMRⁱ	P58753
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	84 – 221	TIRPROSITE-ProRule annotationAdd BLAST		138

Phylogenomic databases

eggNOGⁱ	ENOG410IVIY Eukaryota ENOG411205V LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00510000048428
HOGENOMⁱ	HOG000068972
HOVERGENⁱ	HBG054203
InParanoidⁱ	P58753
KEGG Orthology (KO) More...KOⁱ	K05403
OMAⁱ	GFHQVKE
Database of Orthologous Groups More...OrthoDBⁱ	1327598at2759
PhylomeDBⁱ	P58753
TreeFamⁱ	TF330734

Family and domain databases

Gene3Dⁱ	3.40.50.10140, 1 hit
InterProⁱ	View protein in InterPro IPR000157 TIR_dom IPR017279 Tol-interleuk_rcpt_adapt_Tirap IPR035897 Toll_tir_struct_dom_sf
PANTHERⁱ	PTHR22662 PTHR22662, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF13676 TIR_2, 1 hit
PIRSFⁱ	PIRSF037750 TIR_Tirap, 1 hit
SUPFAMⁱ	SSF52200 SSF52200, 1 hit
PROSITEⁱ	View protein in PROSITE PS50104 TIR, 1 hit

Sequences (3+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 3 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show all Align All

Isoform 1 (identifier: P58753-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASSTSLPAP GSRPKKPLGK MADWFRQTLL KKPKKRPNSP ESTSSDASQP 
        60         70         80         90        100
TSQDSPLPPS LSSVTSPSLP PTHASDSGSS RWSKDYDVCV CHSEEDLVAA 
       110        120        130        140        150
QDLVSYLEGS TASLRCFLQL RDATPGGAIV SELCQALSSS HCRVLLITPG 
       160        170        180        190        200
FLQDPWCKYQ MLQALTEAPG AEGCTIPLLS GLSRAAYPPE LRFMYYVDGR 
       210        220 
GPDGGFRQVK EAVMRYLQTL S

Length:221

Mass (Da):23,883

Last modified:July 19, 2004 - v2

Checksum:ⁱ44A8454D04704540

GO

Isoform 2 (identifier: P58753-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
216-221: YLQTLS → CKLLQEGEGERDSATVSDLL

« Hide

        10         20         30         40         50
MASSTSLPAP GSRPKKPLGK MADWFRQTLL KKPKKRPNSP ESTSSDASQP 
        60         70         80         90        100
TSQDSPLPPS LSSVTSPSLP PTHASDSGSS RWSKDYDVCV CHSEEDLVAA 
       110        120        130        140        150
QDLVSYLEGS TASLRCFLQL RDATPGGAIV SELCQALSSS HCRVLLITPG 
       160        170        180        190        200
FLQDPWCKYQ MLQALTEAPG AEGCTIPLLS GLSRAAYPPE LRFMYYVDGR 
       210        220        230 
GPDGGFRQVK EAVMRCKLLQ EGEGERDSAT VSDLL

Show »

Length:235

Mass (Da):25,323

Checksum:ⁱ383386AA03B70F32

GO

Isoform 3 (identifier: P58753-3) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
221-221: S → WHLLYHGTPEIGVKLETENPCRASDSHKCDKRYRE

« Hide

        10         20         30         40         50
MASSTSLPAP GSRPKKPLGK MADWFRQTLL KKPKKRPNSP ESTSSDASQP 
        60         70         80         90        100
TSQDSPLPPS LSSVTSPSLP PTHASDSGSS RWSKDYDVCV CHSEEDLVAA 
       110        120        130        140        150
QDLVSYLEGS TASLRCFLQL RDATPGGAIV SELCQALSSS HCRVLLITPG 
       160        170        180        190        200
FLQDPWCKYQ MLQALTEAPG AEGCTIPLLS GLSRAAYPPE LRFMYYVDGR 
       210        220        230        240        250
GPDGGFRQVK EAVMRYLQTL WHLLYHGTPE IGVKLETENP CRASDSHKCD 

KRYRE

Show »

Length:255

Mass (Da):27,948

Checksum:ⁱ97287F7E2A010915

GO

Computationally mapped potential isoform sequencesⁱ

There is 1 potential isoform mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name		Protein names	Gene names	Length	Annotation

	F5H2K1	F5H2K1_HUMAN		Toll/interleukin-1 receptor domain-... Toll/interleukin-1 receptor domain-containing adapter protein	TIRAP	49	Annotation score:

Polymorphismⁱ

Genetic variations in TIRAP may influence susceptibility or resistance to invasive pneumococcal disease [MIMⁱ:610799], malaria [MIMⁱ:611162], and tuberculosis [MIMⁱ:607948]. It may define the bacteremia susceptibility locus 1 (BACTS1) [MIMⁱ:614382].2 Publications

Natural variant

Feature key	Position(s)	DescriptionActions	Length
Natural variantⁱVAR_019143	9	A → P Does not affect NF-kappa-B activation and TNF-alpha production. 2 PublicationsCorresponds to variant dbSNP:rs8177369Ensembl.	1
Natural variantⁱVAR_019144	13	R → W Does not affect NF-kappa-B activation and TNF-alpha production. 2 PublicationsCorresponds to variant dbSNP:rs8177399Ensembl.	1
Natural variantⁱVAR_036691	55	S → N Does not affect NF-kappa-B activation and TNF-alpha production. 2 PublicationsCorresponds to variant dbSNP:rs3802813Ensembl.	1
Natural variantⁱVAR_019145	96	D → N Hypomorphic variant resulting in impaired NF-kappa-B activation and TNF-alpha production; cannot bind MYD88. 2 PublicationsCorresponds to variant dbSNP:rs8177400Ensembl.	1
Natural variantⁱVAR_019146	180	S → L At heterozygosity it protects against invasive pneumococcal disease, malaria, bacteremia and tuberculosis; does not affect NF-kappa-B activation and TNF-alpha production; attenuates TLR2 signal transduction. 4 PublicationsCorresponds to variant dbSNP:rs8177374EnsemblClinVar.	1
Natural variantⁱVAR_061713	197	V → I Does not affect NF-kappa-B activation and TNF-alpha production. 1 PublicationCorresponds to variant dbSNP:rs7932976Ensembl.	1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_010765	216 – 221	YLQTLS → CKLLQEGEGERDSATVSDLL in isoform 2. 4 Publications		6
Alternative sequenceⁱVSP_017239	221	S → WHLLYHGTPEIGVKLETENP CRASDSHKCDKRYRE in isoform 3. 1 Publication		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF406652 mRNA Translation: AAL01160.1 AF378129 mRNA Translation: AAL05627.1 AF410783 mRNA Translation: AAL05036.1 AY576785 mRNA Translation: AAT90417.1 AY576786 mRNA Translation: AAT90418.1 AY576787 mRNA Translation: AAT90419.1 AB446477 mRNA Translation: BAG55254.1 AK124298 mRNA Translation: BAG54027.1 AK313147 mRNA Translation: BAG35965.1 AY282416 Genomic DNA Translation: AAP31973.1 AP001318 Genomic DNA No translation available. CH471065 Genomic DNA Translation: EAW67687.1 CH471065 Genomic DNA Translation: EAW67689.1 BC032474 mRNA Translation: AAH32474.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS41731.1 [P58753-2] CCDS8472.1 [P58753-1]
NCBI Reference Sequences More...RefSeqⁱ	NP_001034750.1, NM_001039661.1 [P58753-1] NP_001305705.1, NM_001318776.1 [P58753-2] NP_001305706.1, NM_001318777.1 [P58753-1] NP_683708.1, NM_148910.2 [P58753-2] XP_005271456.2, XM_005271399.3 XP_011540878.1, XM_011542576.2 XP_016872651.1, XM_017017162.1
UniGeneⁱ	Hs.537126

Genome annotation databases

Ensemblⁱ	ENST00000392678; ENSP00000376445; ENSG00000150455 [P58753-2] ENST00000392679; ENSP00000376446; ENSG00000150455 [P58753-1] ENST00000392680; ENSP00000376447; ENSG00000150455 [P58753-1] ENST00000479770; ENSP00000436967; ENSG00000150455 [P58753-1]
GeneIDⁱ	114609
KEGGⁱ	hsa:114609
UCSC genome browser More...UCSCⁱ	uc001qdl.2 human [P58753-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing, Polymorphism

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P58753	Toll-interleukin 1 receptor (TIR) domain containing adaptor protein, isoform CRA_a		HUMAN		221	UniRef100_P58753
TIR domain-containing adaptor protein		PANTR		221
TIR domain-containing adaptor protein		PANPA		221
UPI0007DB9142		PANTR		330
P58753-2	TIR domain containing adaptor protein		PANTR		235	UniRef100_K7CIJ8
UPI0007DBC8C4		PANTR		344

Protein	Similar proteins		Species	Score	Length	Source
P58753	Toll-interleukin 1 receptor (TIR) domain containing adaptor protein, isoform CRA_a		HUMAN		221	UniRef90_P58753
TIR domain-containing adaptor protein		PANTR		221
TIR domain-containing adaptor protein		PANPA		221
TIR domain containing adaptor protein		PANTR		235
Isoform 2 of Toll/interleukin-1 receptor domain-containing adapter protein		HUMAN		235
+2
P58753-3	TIR domain-containing adaptor protein		MACFA		220	UniRef90_P58753-3
TIR domain containing adaptor protein		CERAT		220
TIR domain containing adaptor protein		PAPAN		220
TIR domain containing adaptor protein		MANLE		220
TIR domain containing adaptor protein		MACNE		220
+8

Protein	Similar proteins		Species	Score	Length	Source
P58753	Toll-interleukin 1 receptor (TIR) domain containing adaptor protein, isoform CRA_a		HUMAN		221	UniRef50_P58753
TIR domain-containing adaptor protein		PANTR		221
TIR domain-containing adaptor protein		PANPA		221
UPI000B4F5F9C		MERUN		410
TIR domain containing adaptor protein		PANTR		235
+4
P58753-3	TIR domain containing adaptor protein		COLAP		220	UniRef50_P58753-3
TIR domain-containing adaptor protein		MACMU		220
TIR domain containing adaptor protein		CHLSB		220
TIR domain-containing adaptor protein		MACFA		220
TIR domain containing adaptor protein		CERAT		220
+62

Cross-referencesⁱ

Web resourcesⁱ

SeattleSNPs

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	AF406652 mRNA Translation: AAL01160.1 AF378129 mRNA Translation: AAL05627.1 AF410783 mRNA Translation: AAL05036.1 AY576785 mRNA Translation: AAT90417.1 AY576786 mRNA Translation: AAT90418.1 AY576787 mRNA Translation: AAT90419.1 AB446477 mRNA Translation: BAG55254.1 AK124298 mRNA Translation: BAG54027.1 AK313147 mRNA Translation: BAG35965.1 AY282416 Genomic DNA Translation: AAP31973.1 AP001318 Genomic DNA No translation available. CH471065 Genomic DNA Translation: EAW67687.1 CH471065 Genomic DNA Translation: EAW67689.1 BC032474 mRNA Translation: AAH32474.1
CCDSⁱ	CCDS41731.1 [P58753-2] CCDS8472.1 [P58753-1]
RefSeqⁱ	NP_001034750.1, NM_001039661.1 [P58753-1] NP_001305705.1, NM_001318776.1 [P58753-2] NP_001305706.1, NM_001318777.1 [P58753-1] NP_683708.1, NM_148910.2 [P58753-2] XP_005271456.2, XM_005271399.3 XP_011540878.1, XM_011542576.2 XP_016872651.1, XM_017017162.1
UniGeneⁱ	Hs.537126

3D structure databases

Select the link destinations: PDBeⁱ RCSB PDBⁱ PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2NDH	NMR	-	A	79-221	[»]
	2Y92	X-ray	3.01	A	79-221	[»]
	3UB2	X-ray	2.40	A	78-221	[»]
	3UB3	X-ray	2.75	A	78-221	[»]
	3UB4	X-ray	3.10	A	78-221	[»]
	4FZ5	X-ray	3.60	A/B	72-221	[»]
	4LQD	X-ray	2.45	A	81-221	[»]
	5T7Q	NMR	-	A	15-35	[»]
	5UZB	electron microscopy	7.00	A/B/C/D/E/F/G/H/I/J/K/L/M/N	79-221	[»]
ProteinModelPortalⁱ	P58753
SMRⁱ	P58753
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	125325, 41 interactors
DIPⁱ	DIP-33489N
IntActⁱ	P58753, 38 interactors
MINTⁱ	P58753
STRINGⁱ	9606.ENSP00000376445

PTM databases

iPTMnetⁱ	P58753
PhosphoSitePlusⁱ	P58753

Polymorphism and mutation databases

BioMutaⁱ	TIRAP
DMDMⁱ	50403750

Proteomic databases

jPOSTⁱ	P58753
PaxDbⁱ	P58753
PeptideAtlasⁱ	P58753
PRIDEⁱ	P58753
ProteomicsDBⁱ	57101 57102 [P58753-2] 57103 [P58753-3]

Protocols and materials databases

The DNASU plasmid repository More...DNASUⁱ	114609
Structural Biology Knowledgebase	Search...

Genome annotation databases

Ensemblⁱ	ENST00000392678; ENSP00000376445; ENSG00000150455 [P58753-2] ENST00000392679; ENSP00000376446; ENSG00000150455 [P58753-1] ENST00000392680; ENSP00000376447; ENSG00000150455 [P58753-1] ENST00000479770; ENSP00000436967; ENSG00000150455 [P58753-1]
GeneIDⁱ	114609
KEGGⁱ	hsa:114609
UCSCⁱ	uc001qdl.2 human [P58753-1]

Organism-specific databases

CTDⁱ	114609
DisGeNETⁱ	114609
EuPathDBⁱ	HostDB:ENSG00000150455.13
GeneCardsⁱ	TIRAP
HGNCⁱ	HGNC:17192 TIRAP
HPAⁱ	HPA054431
MalaCardsⁱ	TIRAP
MIMⁱ	606252 gene 607948 phenotype 610799 phenotype 611162 phenotype 614382 phenotype
neXtProtⁱ	NX_P58753
OpenTargetsⁱ	ENSG00000150455
PharmGKBⁱ	PA134972842
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	ENOG410IVIY Eukaryota ENOG411205V LUCA
GeneTreeⁱ	ENSGT00510000048428
HOGENOMⁱ	HOG000068972
HOVERGENⁱ	HBG054203
InParanoidⁱ	P58753
KOⁱ	K05403
OMAⁱ	GFHQVKE
OrthoDBⁱ	1327598at2759
PhylomeDBⁱ	P58753
TreeFamⁱ	TF330734

Enzyme and pathway databases

Reactomeⁱ	R-HSA-1236974 ER-Phagosome pathway R-HSA-166058 MyD88:MAL(TIRAP) cascade initiated on plasma membrane R-HSA-5602498 MyD88 deficiency (TLR2/4) R-HSA-5603041 IRAK4 deficiency (TLR2/4)
SignaLinkⁱ	P58753
SIGNORⁱ	P58753

Miscellaneous databases

GenomeRNAiⁱ	114609
Protein Ontology More...PROⁱ	PR:P58753
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000150455 Expressed in 117 organ(s), highest expression level in leukocyte
CleanExⁱ	HS_MAL HS_TIRAP
ExpressionAtlasⁱ	P58753 baseline and differential
Genevisibleⁱ	P58753 HS

Family and domain databases

Gene3Dⁱ	3.40.50.10140, 1 hit
InterProⁱ	View protein in InterPro IPR000157 TIR_dom IPR017279 Tol-interleuk_rcpt_adapt_Tirap IPR035897 Toll_tir_struct_dom_sf
PANTHERⁱ	PTHR22662 PTHR22662, 1 hit
Pfamⁱ	View protein in Pfam PF13676 TIR_2, 1 hit
PIRSFⁱ	PIRSF037750 TIR_Tirap, 1 hit
SUPFAMⁱ	SSF52200 SSF52200, 1 hit
PROSITEⁱ	View protein in PROSITE PS50104 TIR, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	TIRAP_HUMAN
Accessionⁱ	P58753Primary (citable) accession number: P58753 Secondary accession number(s): B3KW65 , Q56UH9, Q56UI0, Q8N5E5
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	March 27, 2002
	Last sequence update:	July 19, 2004
	Last modified:	January 16, 2019
	This is version 159 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

Documents

Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations
Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
PDB cross-references
Index of Protein Data Bank (PDB) cross-references
Human chromosome 11
Human chromosome 11: entries, gene names and cross-references to MIM

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P58753 (TIRAP_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Toll/interleukin-1 receptor domain-containing adapter protein

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Plasma membrane

Other locations

Cytosol

Plasma Membrane

Other locations

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Phylogenomic databases

Family and domain databases

Natural variant

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Web resourcesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ