Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 162 (05 Jun 2019)
Sequence version 2 (19 Jul 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Toll/interleukin-1 receptor domain-containing adapter protein

Gene

TIRAP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Adapter involved in TLR2 and TLR4 signaling pathways in the innate immune response. Acts via IRAK2 and TRAF-6, leading to the activation of NF-kappa-B, MAPK1, MAPK3 and JNK, and resulting in cytokine secretion and the inflammatory response. Positively regulates the production of TNF-alpha and interleukin-6.2 Publications

Caution

Variant Leu-180 has been reported to reduce TLR2 signal transduction (PubMed:17322885). In contrast, PubMed:19509286 reports that this variant is fully active and has no effect on signal transduction pathways and cytokine production.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processImmunity, Inflammatory response, Innate immunity

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-1236974 ER-Phagosome pathway
R-HSA-166058 MyD88:MAL(TIRAP) cascade initiated on plasma membrane
R-HSA-5602498 MyD88 deficiency (TLR2/4)
R-HSA-5603041 IRAK4 deficiency (TLR2/4)

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P58753

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P58753

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Toll/interleukin-1 receptor domain-containing adapter protein
Short name:
TIR domain-containing adapter protein
Alternative name(s):
Adaptor protein Wyatt
MyD88 adapter-like protein
Short name:
MyD88-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TIRAP
Synonyms:MAL
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17192 TIRAP

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
606252 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P58753

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi125P → H: Abolishes NF-kappa-B activation. 2 Publications1

Organism-specific databases

DisGeNET

More...
DisGeNETi
114609

MalaCards human disease database

More...
MalaCardsi
TIRAP
MIMi607948 phenotype
610799 phenotype
611162 phenotype
614382 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000150455

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134972842

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TIRAP

Domain mapping of disease mutations (DMDM)

More...
DMDMi
50403750

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000725471 – 221Toll/interleukin-1 receptor domain-containing adapter proteinAdd BLAST221

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi89 ↔ 1341 Publication
Disulfide bondi142 ↔ 1741 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated by IRAK1 and IRAK4. Also phosphorylated by BTK.
Polyubiquitinated. Polyubiquitination follows phosphorylation by BTK and leads to TIRAP degradation.1 Publication

Keywords - PTMi

Disulfide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P58753

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P58753

PeptideAtlas

More...
PeptideAtlasi
P58753

PRoteomics IDEntifications database

More...
PRIDEi
P58753

ProteomicsDB human proteome resource

More...
ProteomicsDBi
57101
57102 [P58753-2]
57103 [P58753-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P58753

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P58753

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in liver, kidney, spleen, skeletal muscle and heart. Also detected in peripheral blood leukocytes, lung, placenta, small intestine, thymus, colon and brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000150455 Expressed in 117 organ(s), highest expression level in leukocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P58753 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P58753 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA054431

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Also forms heterodimers with MYD88. May interact with PIK3AP1 (By similarity). Interacts with TLR4 and IRAK2 via their respective TIR domains. Interacts with BMX and TBK1. Interacts with EIF2AK2. Does not interact with IRAK1, nor TLR9.By similarity6 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125325, 43 interactors

Database of interacting proteins

More...
DIPi
DIP-33489N

Protein interaction database and analysis system

More...
IntActi
P58753, 38 interactors

Molecular INTeraction database

More...
MINTi
P58753

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000376445

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1221
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P58753

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini84 – 221TIRPROSITE-ProRule annotationAdd BLAST138

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IVIY Eukaryota
ENOG411205V LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000048428

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000068972

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P58753

KEGG Orthology (KO)

More...
KOi
K05403

Identification of Orthologs from Complete Genome Data

More...
OMAi
GFHQVKE

Database of Orthologous Groups

More...
OrthoDBi
1327598at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P58753

TreeFam database of animal gene trees

More...
TreeFami
TF330734

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.10140, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000157 TIR_dom
IPR017279 Tol-interleuk_rcpt_adapt_Tirap
IPR035897 Toll_tir_struct_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR22662 PTHR22662, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13676 TIR_2, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF037750 TIR_Tirap, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52200 SSF52200, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50104 TIR, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P58753-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASSTSLPAP GSRPKKPLGK MADWFRQTLL KKPKKRPNSP ESTSSDASQP
60 70 80 90 100
TSQDSPLPPS LSSVTSPSLP PTHASDSGSS RWSKDYDVCV CHSEEDLVAA
110 120 130 140 150
QDLVSYLEGS TASLRCFLQL RDATPGGAIV SELCQALSSS HCRVLLITPG
160 170 180 190 200
FLQDPWCKYQ MLQALTEAPG AEGCTIPLLS GLSRAAYPPE LRFMYYVDGR
210 220
GPDGGFRQVK EAVMRYLQTL S
Length:221
Mass (Da):23,883
Last modified:July 19, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i44A8454D04704540
GO
Isoform 2 (identifier: P58753-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     216-221: YLQTLS → CKLLQEGEGERDSATVSDLL

Show »
Length:235
Mass (Da):25,323
Checksum:i383386AA03B70F32
GO
Isoform 3 (identifier: P58753-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     221-221: S → WHLLYHGTPEIGVKLETENPCRASDSHKCDKRYRE

Show »
Length:255
Mass (Da):27,948
Checksum:i97287F7E2A010915
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H2K1F5H2K1_HUMAN
Toll/interleukin-1 receptor domain-...
TIRAP
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section provides information on polymorphic variants. If the variant is associated with a disease state, the description of the latter can be found in the <a href="http://www.uniprot.org/manual/involvement_in_disease">'Involvement in disease'</a> subsection.<p><a href='/help/polymorphism' target='_top'>More...</a></p>Polymorphismi

Genetic variations in TIRAP may influence susceptibility or resistance to invasive pneumococcal disease [MIMi:610799], malaria [MIMi:611162], and tuberculosis [MIMi:607948]. It may define the bacteremia susceptibility locus 1 (BACTS1) [MIMi:614382].2 Publications

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0191439A → P Does not affect NF-kappa-B activation and TNF-alpha production. 2 PublicationsCorresponds to variant dbSNP:rs8177369Ensembl.1
Natural variantiVAR_01914413R → W Does not affect NF-kappa-B activation and TNF-alpha production. 2 PublicationsCorresponds to variant dbSNP:rs8177399Ensembl.1
Natural variantiVAR_03669155S → N Does not affect NF-kappa-B activation and TNF-alpha production. 2 PublicationsCorresponds to variant dbSNP:rs3802813Ensembl.1
Natural variantiVAR_01914596D → N Hypomorphic variant resulting in impaired NF-kappa-B activation and TNF-alpha production; cannot bind MYD88. 2 PublicationsCorresponds to variant dbSNP:rs8177400Ensembl.1
Natural variantiVAR_019146180S → L At heterozygosity it protects against invasive pneumococcal disease, malaria, bacteremia and tuberculosis; does not affect NF-kappa-B activation and TNF-alpha production; attenuates TLR2 signal transduction. 4 PublicationsCorresponds to variant dbSNP:rs8177374EnsemblClinVar.1
Natural variantiVAR_061713197V → I Does not affect NF-kappa-B activation and TNF-alpha production. 1 PublicationCorresponds to variant dbSNP:rs7932976Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_010765216 – 221YLQTLS → CKLLQEGEGERDSATVSDLL in isoform 2. 4 Publications6
Alternative sequenceiVSP_017239221S → WHLLYHGTPEIGVKLETENP CRASDSHKCDKRYRE in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF406652 mRNA Translation: AAL01160.1
AF378129 mRNA Translation: AAL05627.1
AF410783 mRNA Translation: AAL05036.1
AY576785 mRNA Translation: AAT90417.1
AY576786 mRNA Translation: AAT90418.1
AY576787 mRNA Translation: AAT90419.1
AB446477 mRNA Translation: BAG55254.1
AK124298 mRNA Translation: BAG54027.1
AK313147 mRNA Translation: BAG35965.1
AY282416 Genomic DNA Translation: AAP31973.1
AP001318 Genomic DNA No translation available.
CH471065 Genomic DNA Translation: EAW67687.1
CH471065 Genomic DNA Translation: EAW67689.1
BC032474 mRNA Translation: AAH32474.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS41731.1 [P58753-2]
CCDS8472.1 [P58753-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001034750.1, NM_001039661.1 [P58753-1]
NP_001305705.1, NM_001318776.1 [P58753-2]
NP_001305706.1, NM_001318777.1 [P58753-1]
NP_683708.1, NM_148910.2 [P58753-2]
XP_005271456.2, XM_005271399.3
XP_011540878.1, XM_011542576.2
XP_016872651.1, XM_017017162.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000392678; ENSP00000376445; ENSG00000150455 [P58753-2]
ENST00000392679; ENSP00000376446; ENSG00000150455 [P58753-1]
ENST00000392680; ENSP00000376447; ENSG00000150455 [P58753-1]
ENST00000479770; ENSP00000436967; ENSG00000150455 [P58753-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
114609

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:114609

UCSC genome browser

More...
UCSCi
uc001qdl.2 human [P58753-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF406652 mRNA Translation: AAL01160.1
AF378129 mRNA Translation: AAL05627.1
AF410783 mRNA Translation: AAL05036.1
AY576785 mRNA Translation: AAT90417.1
AY576786 mRNA Translation: AAT90418.1
AY576787 mRNA Translation: AAT90419.1
AB446477 mRNA Translation: BAG55254.1
AK124298 mRNA Translation: BAG54027.1
AK313147 mRNA Translation: BAG35965.1
AY282416 Genomic DNA Translation: AAP31973.1
AP001318 Genomic DNA No translation available.
CH471065 Genomic DNA Translation: EAW67687.1
CH471065 Genomic DNA Translation: EAW67689.1
BC032474 mRNA Translation: AAH32474.1
CCDSiCCDS41731.1 [P58753-2]
CCDS8472.1 [P58753-1]
RefSeqiNP_001034750.1, NM_001039661.1 [P58753-1]
NP_001305705.1, NM_001318776.1 [P58753-2]
NP_001305706.1, NM_001318777.1 [P58753-1]
NP_683708.1, NM_148910.2 [P58753-2]
XP_005271456.2, XM_005271399.3
XP_011540878.1, XM_011542576.2
XP_016872651.1, XM_017017162.1

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2NDHNMR-A79-221[»]
2Y92X-ray3.01A79-221[»]
3UB2X-ray2.40A78-221[»]
3UB3X-ray2.75A78-221[»]
3UB4X-ray3.10A78-221[»]
4FZ5X-ray3.60A/B72-221[»]
4LQDX-ray2.45A81-221[»]
5T7QNMR-A15-35[»]
5UZBelectron microscopy7.00A/B/C/D/E/F/G/H/I/J/K/L/M/N79-221[»]
SMRiP58753
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125325, 43 interactors
DIPiDIP-33489N
IntActiP58753, 38 interactors
MINTiP58753
STRINGi9606.ENSP00000376445

PTM databases

iPTMnetiP58753
PhosphoSitePlusiP58753

Polymorphism and mutation databases

BioMutaiTIRAP
DMDMi50403750

Proteomic databases

jPOSTiP58753
PaxDbiP58753
PeptideAtlasiP58753
PRIDEiP58753
ProteomicsDBi57101
57102 [P58753-2]
57103 [P58753-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
114609
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000392678; ENSP00000376445; ENSG00000150455 [P58753-2]
ENST00000392679; ENSP00000376446; ENSG00000150455 [P58753-1]
ENST00000392680; ENSP00000376447; ENSG00000150455 [P58753-1]
ENST00000479770; ENSP00000436967; ENSG00000150455 [P58753-1]
GeneIDi114609
KEGGihsa:114609
UCSCiuc001qdl.2 human [P58753-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
114609
DisGeNETi114609

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TIRAP
HGNCiHGNC:17192 TIRAP
HPAiHPA054431
MalaCardsiTIRAP
MIMi606252 gene
607948 phenotype
610799 phenotype
611162 phenotype
614382 phenotype
neXtProtiNX_P58753
OpenTargetsiENSG00000150455
PharmGKBiPA134972842

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IVIY Eukaryota
ENOG411205V LUCA
GeneTreeiENSGT00510000048428
HOGENOMiHOG000068972
InParanoidiP58753
KOiK05403
OMAiGFHQVKE
OrthoDBi1327598at2759
PhylomeDBiP58753
TreeFamiTF330734

Enzyme and pathway databases

ReactomeiR-HSA-1236974 ER-Phagosome pathway
R-HSA-166058 MyD88:MAL(TIRAP) cascade initiated on plasma membrane
R-HSA-5602498 MyD88 deficiency (TLR2/4)
R-HSA-5603041 IRAK4 deficiency (TLR2/4)
SignaLinkiP58753
SIGNORiP58753

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
114609

Protein Ontology

More...
PROi
PR:P58753

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000150455 Expressed in 117 organ(s), highest expression level in leukocyte
ExpressionAtlasiP58753 baseline and differential
GenevisibleiP58753 HS

Family and domain databases

Gene3Di3.40.50.10140, 1 hit
InterProiView protein in InterPro
IPR000157 TIR_dom
IPR017279 Tol-interleuk_rcpt_adapt_Tirap
IPR035897 Toll_tir_struct_dom_sf
PANTHERiPTHR22662 PTHR22662, 1 hit
PfamiView protein in Pfam
PF13676 TIR_2, 1 hit
PIRSFiPIRSF037750 TIR_Tirap, 1 hit
SUPFAMiSSF52200 SSF52200, 1 hit
PROSITEiView protein in PROSITE
PS50104 TIR, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTIRAP_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P58753
Secondary accession number(s): B3KW65
, Q56UH9, Q56UI0, Q8N5E5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 27, 2002
Last sequence update: July 19, 2004
Last modified: June 5, 2019
This is version 162 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again