Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Myeloid leukemia factor 1

Gene

MLF1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. Interferes with erythropoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. Suppresses COP1 activity via CSN3 which activates p53 and induces cell cycle arrest. Binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • DNA binding Source: UniProtKB
  • protein domain specific binding Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, DNA-binding
Biological processCell cycle, Differentiation

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P58340

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
P58340 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Myeloid leukemia factor 1
Alternative name(s):
Myelodysplasia-myeloid leukemia factor 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MLF1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000178053.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:7125 MLF1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601402 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P58340

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving MLF1 is a cause of myelodysplastic syndrome (MDS). Translocation t(3;5)(q25.1;q34) with NPM1/NPM.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei16 – 17Breakpoint for translocation to form NPM-MLF12

Organism-specific databases

DisGeNET

More...
DisGeNETi
4291

MalaCards human disease database

More...
MalaCardsi
MLF1

Open Targets

More...
OpenTargetsi
ENSG00000178053

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA30843

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MLF1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
17368170

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002207521 – 268Myeloid leukemia factor 1Add BLAST268

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei8PhosphoserineCombined sources1
Modified residuei32PhosphoserineCombined sources1
Modified residuei34Phosphoserine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation is required for binding to YWHAZ.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P58340

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P58340

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P58340

PeptideAtlas

More...
PeptideAtlasi
P58340

PRoteomics IDEntifications database

More...
PRIDEi
P58340

ProteomicsDB human proteome resource

More...
ProteomicsDBi
57064
57065 [P58340-2]
57066 [P58340-3]
57067 [P58340-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P58340

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P58340

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Most abundant in testis, ovary, skeletal muscle, heart, kidney and colon. Low expression in spleen, thymus and peripheral blood leukocytes.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000178053 Expressed in 225 organ(s), highest expression level in right testis

CleanEx database of gene expression profiles

More...
CleanExi
HS_MLF1

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P58340 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P58340 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CENPU. Also interacts with NRBP1/MADM, YWHAZ/14-3-3-zeta and HNRPUL2/MANP. NRBP1 recruits a serine kinase which phosphorylates both itself and MLF1. Phosphorylated MLF1 then binds to YWHAZ and is retained in the cytoplasm. Retained in the nucleus by binding to HNRPUL2. Binds to COPS3/CSN3 which is required for suppression of COP1 and activation of p53.3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
110437, 72 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P58340

Protein interaction database and analysis system

More...
IntActi
P58340, 90 interactors

Molecular INTeraction database

More...
MINTi
P58340

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3UALX-ray1.80P29-42[»]
3UBWX-ray1.90P29-42[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P58340

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P58340

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni50 – 125Interaction with COPS31 PublicationAdd BLAST76

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MLF family.Curated

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000005023

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000045671

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG019060

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P58340

KEGG Orthology (KO)

More...
KOi
K15622

Identification of Orthologs from Complete Genome Data

More...
OMAi
NPFQAMD

Database of Orthologous Groups

More...
OrthoDBi
1471165at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P58340

TreeFam database of animal gene trees

More...
TreeFami
TF317561

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019376 Myeloid_leukemia_factor

The PANTHER Classification System

More...
PANTHERi
PTHR13105 PTHR13105, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10248 Mlf1IP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P58340-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFRMLNSSFE DDPFFSESIL AHRENMRQMI RSFSEPFGRD LLSISDGRGR
60 70 80 90 100
AHNRRGHNDG EDSLTHTDVS SFQTMDQMVS NMRNYMQKLE RNFGQLSVDP
110 120 130 140 150
NGHSFCSSSV MTYSKIGDEP PKVFQASTQT RRAPGGIKET RKAMRDSDSG
160 170 180 190 200
LEKMAIGHHI HDRAHVIKKS KNKKTGDEEV NQEFINMNES DAHAFDEEWQ
210 220 230 240 250
SEVLKYKPGR HNLGNTRMRS VGHENPGSRE LKRREKPQQS PAIEHGRRSN
260
VLGDKLHIKG SSVKSNKK
Length:268
Mass (Da):30,627
Last modified:November 2, 2001 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i08774217329F737A
GO
Isoform 2 (identifier: P58340-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: Missing.
     94-136: Missing.

Show »
Length:200
Mass (Da):23,117
Checksum:iCFF347E5F40C1BFF
GO
Isoform 3 (identifier: P58340-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MFRMLNSSFEDDPFF → MLKEVLQREGKSYKSETLMYIKKARASENKL
     65-65: T → TATSCSLVPFGDFGGM

Note: No experimental confirmation available.
Show »
Length:299
Mass (Da):33,888
Checksum:i75E81192D63D7948
GO
Isoform 5 (identifier: P58340-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: Missing.

Show »
Length:243
Mass (Da):27,625
Checksum:i061E87A385C3E063
GO
Isoform 4 (identifier: P58340-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-25: Missing.
     65-65: T → TATSCSLVPFGDFGGM

Note: No experimental confirmation available.
Show »
Length:258
Mass (Da):29,095
Checksum:i68BC1583FCAA0F23
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JNE5C9JNE5_HUMAN
Myeloid leukemia factor 1
MLF1
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J3M3C9J3M3_HUMAN
Myeloid leukemia factor 1
MLF1
204Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9K0D4C9K0D4_HUMAN
Myeloid leukemia factor 1
MLF1
188Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9K0D3C9K0D3_HUMAN
Myeloid leukemia factor 1
MLF1
174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEY0F8WEY0_HUMAN
Myeloid leukemia factor 1
MLF1
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VXT4F8VXT4_HUMAN
Myeloid leukemia factor 1
MLF1
40Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_022070226P → T. Corresponds to variant dbSNP:rs15967Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0431301 – 25Missing in isoform 2, isoform 4 and isoform 5. 2 PublicationsAdd BLAST25
Alternative sequenceiVSP_0437251 – 15MFRML…DDPFF → MLKEVLQREGKSYKSETLMY IKKARASENKL in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_04372665T → TATSCSLVPFGDFGGM in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_04313194 – 136Missing in isoform 2. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L49054 mRNA Translation: AAA99997.1
AY848700 mRNA Translation: AAX46015.1
AY848702 mRNA Translation: AAX46017.1
AK056948 mRNA Translation: BAB71320.1
AK096889 mRNA Translation: BAC04885.1
AK297488 mRNA Translation: BAG59906.1
AC025033 Genomic DNA No translation available.
AC106707 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW78689.1
CH471052 Genomic DNA Translation: EAW78690.1
BC007045 mRNA Translation: AAH07045.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3182.1 [P58340-1]
CCDS46945.1 [P58340-5]
CCDS56286.1 [P58340-3]
CCDS56287.1 [P58340-4]
CCDS56288.1 [P58340-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001123628.1, NM_001130156.2 [P58340-5]
NP_001123629.1, NM_001130157.2 [P58340-5]
NP_001182361.1, NM_001195432.1 [P58340-3]
NP_001182362.1, NM_001195433.1 [P58340-2]
NP_001182363.1, NM_001195434.1 [P58340-4]
NP_071888.1, NM_022443.4 [P58340-1]
XP_005247537.1, XM_005247480.2 [P58340-4]
XP_011511154.1, XM_011512852.2 [P58340-4]
XP_011511155.1, XM_011512853.2 [P58340-5]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.85195

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000355893; ENSP00000348157; ENSG00000178053 [P58340-1]
ENST00000359117; ENSP00000352025; ENSG00000178053 [P58340-5]
ENST00000392822; ENSP00000376568; ENSG00000178053 [P58340-3]
ENST00000469452; ENSP00000418595; ENSG00000178053 [P58340-2]
ENST00000471745; ENSP00000420134; ENSG00000178053 [P58340-4]
ENST00000478894; ENSP00000417777; ENSG00000178053 [P58340-4]
ENST00000482628; ENSP00000417141; ENSG00000178053 [P58340-5]
ENST00000484955; ENSP00000417835; ENSG00000178053 [P58340-5]
ENST00000618075; ENSP00000484169; ENSG00000178053 [P58340-2]
ENST00000619577; ENSP00000483337; ENSG00000178053 [P58340-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
4291

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:4291

UCSC genome browser

More...
UCSCi
uc003fbx.4 human [P58340-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L49054 mRNA Translation: AAA99997.1
AY848700 mRNA Translation: AAX46015.1
AY848702 mRNA Translation: AAX46017.1
AK056948 mRNA Translation: BAB71320.1
AK096889 mRNA Translation: BAC04885.1
AK297488 mRNA Translation: BAG59906.1
AC025033 Genomic DNA No translation available.
AC106707 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW78689.1
CH471052 Genomic DNA Translation: EAW78690.1
BC007045 mRNA Translation: AAH07045.1
CCDSiCCDS3182.1 [P58340-1]
CCDS46945.1 [P58340-5]
CCDS56286.1 [P58340-3]
CCDS56287.1 [P58340-4]
CCDS56288.1 [P58340-2]
RefSeqiNP_001123628.1, NM_001130156.2 [P58340-5]
NP_001123629.1, NM_001130157.2 [P58340-5]
NP_001182361.1, NM_001195432.1 [P58340-3]
NP_001182362.1, NM_001195433.1 [P58340-2]
NP_001182363.1, NM_001195434.1 [P58340-4]
NP_071888.1, NM_022443.4 [P58340-1]
XP_005247537.1, XM_005247480.2 [P58340-4]
XP_011511154.1, XM_011512852.2 [P58340-4]
XP_011511155.1, XM_011512853.2 [P58340-5]
UniGeneiHs.85195

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3UALX-ray1.80P29-42[»]
3UBWX-ray1.90P29-42[»]
ProteinModelPortaliP58340
SMRiP58340
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110437, 72 interactors
ELMiP58340
IntActiP58340, 90 interactors
MINTiP58340

Protein family/group databases

MoonDBiP58340 Predicted

PTM databases

iPTMnetiP58340
PhosphoSitePlusiP58340

Polymorphism and mutation databases

BioMutaiMLF1
DMDMi17368170

Proteomic databases

EPDiP58340
jPOSTiP58340
MaxQBiP58340
PeptideAtlasiP58340
PRIDEiP58340
ProteomicsDBi57064
57065 [P58340-2]
57066 [P58340-3]
57067 [P58340-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355893; ENSP00000348157; ENSG00000178053 [P58340-1]
ENST00000359117; ENSP00000352025; ENSG00000178053 [P58340-5]
ENST00000392822; ENSP00000376568; ENSG00000178053 [P58340-3]
ENST00000469452; ENSP00000418595; ENSG00000178053 [P58340-2]
ENST00000471745; ENSP00000420134; ENSG00000178053 [P58340-4]
ENST00000478894; ENSP00000417777; ENSG00000178053 [P58340-4]
ENST00000482628; ENSP00000417141; ENSG00000178053 [P58340-5]
ENST00000484955; ENSP00000417835; ENSG00000178053 [P58340-5]
ENST00000618075; ENSP00000484169; ENSG00000178053 [P58340-2]
ENST00000619577; ENSP00000483337; ENSG00000178053 [P58340-4]
GeneIDi4291
KEGGihsa:4291
UCSCiuc003fbx.4 human [P58340-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
4291
DisGeNETi4291
EuPathDBiHostDB:ENSG00000178053.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MLF1
HGNCiHGNC:7125 MLF1
MalaCardsiMLF1
MIMi601402 gene
neXtProtiNX_P58340
OpenTargetsiENSG00000178053
PharmGKBiPA30843

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00390000005023
HOGENOMiHOG000045671
HOVERGENiHBG019060
InParanoidiP58340
KOiK15622
OMAiNPFQAMD
OrthoDBi1471165at2759
PhylomeDBiP58340
TreeFamiTF317561

Enzyme and pathway databases

SIGNORiP58340

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MLF1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
MLF1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
4291

Protein Ontology

More...
PROi
PR:P58340

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000178053 Expressed in 225 organ(s), highest expression level in right testis
CleanExiHS_MLF1
ExpressionAtlasiP58340 baseline and differential
GenevisibleiP58340 HS

Family and domain databases

InterProiView protein in InterPro
IPR019376 Myeloid_leukemia_factor
PANTHERiPTHR13105 PTHR13105, 1 hit
PfamiView protein in Pfam
PF10248 Mlf1IP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMLF1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P58340
Secondary accession number(s): E9PEU9
, Q2TLE3, Q2TLE5, Q8N8F8, Q96MH1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 2, 2001
Last sequence update: November 2, 2001
Last modified: January 16, 2019
This is version 143 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again