Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 178 (08 May 2019)
Sequence version 5 (05 Oct 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Anthrax toxin receptor 2

Gene

ANTXR2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Necessary for cellular interactions with laminin and the extracellular matrix.2 Publications

Miscellaneous

Upon binding of the protective antigen (PA) of Bacillus anthracis the complex moves to glycosphingolipid-rich lipid rafts, where it is internalized via a clathrin-dependent pathway. In the endosomal membrane, at pH under 7, the complex then rearranges and forms a pore allowing the other components of anthrax toxin to escape to the cytoplasm.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi52Divalent metal cation1
Metal bindingi54Divalent metal cation1
Metal bindingi118Divalent metal cation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • metal ion binding Source: UniProtKB-KW
  • transmembrane signaling receptor activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
LigandMetal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5210891 Uptake and function of anthrax toxins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Anthrax toxin receptor 2
Alternative name(s):
Capillary morphogenesis gene 2 protein
Short name:
CMG-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ANTXR2
Synonyms:CMG2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:21732 ANTXR2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
608041 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P58335

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini34 – 318ExtracellularSequence analysisAdd BLAST285
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei319 – 341HelicalSequence analysisAdd BLAST23
Topological domaini342 – 489CytoplasmicSequence analysisAdd BLAST148

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Membrane, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Hyaline fibromatosis syndrome (HFS)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive syndrome characterized by abnormal growth of hyalinized fibrous tissue usually affecting subcutaneous regions on the scalp, ears, neck, face, hands, and feet. The lesions appear as pearly papules or fleshy nodules. Additional features include gingival hypertrophy, progressive joint contractures resulting in severe limitation of mobility, osteopenia, and osteoporosis. Disease severity is variable. Some individuals manifest symptoms in infancy and have additional visceral or systemic involvement. Hyaline deposits in multiple organs, recurrent infections and intractable diarrhea often lead to early death. Surviving children may suffer from severely reduced mobility due to joint contractures. Other patients have later onset of a milder disorder affecting only the face and digits.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02268745L → P in HFS; infantile form. 1 PublicationCorresponds to variant dbSNP:rs886041401EnsemblClinVar.1
Natural variantiVAR_022688105G → D in HFS. 1 PublicationCorresponds to variant dbSNP:rs137852902EnsemblClinVar.1
Natural variantiVAR_022689189I → T in HFS; infantile form. 2 PublicationsCorresponds to variant dbSNP:rs137852905EnsemblClinVar.1
Natural variantiVAR_022690218C → R in HFS; infantile form. 1 PublicationCorresponds to variant dbSNP:rs781637328Ensembl.1
Natural variantiVAR_022691293V → VQ in HFS. 1 Publication1
Natural variantiVAR_022692329L → R in HFS. 1 PublicationCorresponds to variant dbSNP:rs137852903EnsemblClinVar.1
Natural variantiVAR_022694381Y → C in HFS. 1 PublicationCorresponds to variant dbSNP:rs137852901EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
118429

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...
GeneReviewsi
ANTXR2

MalaCards human disease database

More...
MalaCardsi
ANTXR2
MIMi228600 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000163297

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
2176 Infantile systemic hyalinosis
2028 Juvenile hyaline fibromatosis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA128394752

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ANTXR2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
306526289

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 33Sequence analysisAdd BLAST33
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000269434 – 489Anthrax toxin receptor 2Add BLAST456

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi39 ↔ 218
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei147PhosphothreonineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi250N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi260N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P58335

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P58335

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P58335

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P58335

PeptideAtlas

More...
PeptideAtlasi
P58335

PRoteomics IDEntifications database

More...
PRIDEi
P58335

ProteomicsDB human proteome resource

More...
ProteomicsDBi
57060
57061 [P58335-2]
57062 [P58335-3]
57063 [P58335-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P58335

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P58335

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P58335

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in prostate, thymus, ovary, testis, pancreas, colon, heart, kidney, lung, liver, peripheral blood leukocytes, placenta, skeletal muscle, small intestine and spleen.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000163297 Expressed in 192 organ(s), highest expression level in layer of synovial tissue

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P58335 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P58335 HS

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds laminin, and possibly also collagen type IV. Binds to the protective antigen (PA) of Bacillus anthracis in a divalent cation-dependent manner, with the following preference: calcium > manganese > magnesium > zinc. Binding of PA leads to heptamerization of the receptor-PA complex.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
pagAP134237EBI-456840,EBI-456868From Bacillus anthracis.

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
125602, 12 interactors

Database of interacting proteins

More...
DIPi
DIP-32476N

Protein interaction database and analysis system

More...
IntActi
P58335, 4 interactors

Molecular INTeraction database

More...
MINTi
P58335

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000306185

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1489
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P58335

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P58335

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini44 – 213VWFAPROSITE-ProRule annotationAdd BLAST170

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi352 – 360Poly-Pro9
Compositional biasi362 – 366Poly-Glu5

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Binding to PA seems to be effected through the VWA domain.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ATR family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IK1W Eukaryota
ENOG410YC57 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156320

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P58335

KEGG Orthology (KO)

More...
KOi
K20909

Identification of Orthologs from Complete Genome Data

More...
OMAi
LMRPQQG

Database of Orthologous Groups

More...
OrthoDBi
1546359at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P58335

TreeFam database of animal gene trees

More...
TreeFami
TF328943

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.410, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017360 Anthrax_toxin_rcpt
IPR008399 Anthrax_toxin_rcpt_C
IPR008400 Anthrax_toxin_rcpt_extracel
IPR002035 VWF_A
IPR036465 vWFA_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR16059:SF13 PTHR16059:SF13, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF05586 Ant_C, 1 hit
PF05587 Anth_Ig, 1 hit
PF00092 VWA, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF038023 Anthrax_toxin_receptor_2, 1 hit

ProDom; a protein domain database

More...
ProDomi
View protein in ProDom or Entries sharing at least one domain
PD377005 Anthrax_toxin_rcpt_C, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00327 VWA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53300 SSF53300, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50234 VWFA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P58335-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVAERSPARS PGSWLFPGLW LLVLSGPGGL LRAQEQPSCR RAFDLYFVLD
60 70 80 90 100
KSGSVANNWI EIYNFVQQLA ERFVSPEMRL SFIVFSSQAT IILPLTGDRG
110 120 130 140 150
KISKGLEDLK RVSPVGETYI HEGLKLANEQ IQKAGGLKTS SIIIALTDGK
160 170 180 190 200
LDGLVPSYAE KEAKISRSLG ASVYCVGVLD FEQAQLERIA DSKEQVFPVK
210 220 230 240 250
GGFQALKGII NSILAQSCTE ILELQPSSVC VGEEFQIVLS GRGFMLGSRN
260 270 280 290 300
GSVLCTYTVN ETYTTSVKPV SVQLNSMLCP APILNKAGET LDVSVSFNGG
310 320 330 340 350
KSVISGSLIV TATECSNGIA AIIVILVLLL LLGIGLMWWF WPLCCKVVIK
360 370 380 390 400
DPPPPPAPAP KEEEEEPLPT KKWPTVDASY YGGRGVGGIK RMEVRWGDKG
410 420 430 440 450
STEEGARLEK AKNAVVKIPE ETEEPIRPRP PRPKPTHQPP QTKWYTPIKG
460 470 480
RLDALWALLR RQYDRVSLMR PQEGDEVCIW ECIEKELTA
Length:489
Mass (Da):53,666
Last modified:October 5, 2010 - v5
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB9F66CCE7A13F807
GO
Isoform 2 (identifier: P58335-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     213-315: Missing.

Show »
Length:386
Mass (Da):42,893
Checksum:i0F9B3873874FABCA
GO
Isoform 3 (identifier: P58335-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     290-322: TLDVSVSFNGGKSVISGSLIVTATECSNGIAAI → WGLTVTQAGVKWHDLTHCTFGLSGSGDPPTSAS
     323-489: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:322
Mass (Da):34,763
Checksum:i19D061AAFBE6CFF8
GO
Isoform 4 (identifier: P58335-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     477-489: VCIWECIEKELTA → GRCINFSRVPSQ

Show »
Length:488
Mass (Da):53,493
Checksum:i1FE0F51BE9FDE0F6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3KPY9J3KPY9_HUMAN
Anthrax toxin receptor
ANTXR2
411Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DG84A0A0C4DG84_HUMAN
Anthrax toxin receptor 2
ANTXR2 hCG_1818780
245Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAY40907 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAB70976 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAD93150 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02268745L → P in HFS; infantile form. 1 PublicationCorresponds to variant dbSNP:rs886041401EnsemblClinVar.1
Natural variantiVAR_022688105G → D in HFS. 1 PublicationCorresponds to variant dbSNP:rs137852902EnsemblClinVar.1
Natural variantiVAR_022689189I → T in HFS; infantile form. 2 PublicationsCorresponds to variant dbSNP:rs137852905EnsemblClinVar.1
Natural variantiVAR_022690218C → R in HFS; infantile form. 1 PublicationCorresponds to variant dbSNP:rs781637328Ensembl.1
Natural variantiVAR_022691293V → VQ in HFS. 1 Publication1
Natural variantiVAR_022692329L → R in HFS. 1 PublicationCorresponds to variant dbSNP:rs137852903EnsemblClinVar.1
Natural variantiVAR_022693357A → P5 PublicationsCorresponds to variant dbSNP:rs12647691EnsemblClinVar.1
Natural variantiVAR_022694381Y → C in HFS. 1 PublicationCorresponds to variant dbSNP:rs137852901EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_008343213 – 315Missing in isoform 2. 1 PublicationAdd BLAST103
Alternative sequenceiVSP_008344290 – 322TLDVS…GIAAI → WGLTVTQAGVKWHDLTHCTF GLSGSGDPPTSAS in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_008345323 – 489Missing in isoform 3. 1 PublicationAdd BLAST167
Alternative sequenceiVSP_008346477 – 489VCIWE…KELTA → GRCINFSRVPSQ in isoform 4. 4 PublicationsAdd BLAST13

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY040326 mRNA Translation: AAK77222.1
AY233452 mRNA Translation: AAP04016.1
AK055636 mRNA Translation: BAB70976.1 Different initiation.
AK091721 mRNA Translation: BAC03731.1
AB209913 mRNA Translation: BAD93150.1 Different initiation.
AC097711 Genomic DNA Translation: AAY40907.1 Sequence problems.
AC109518 Genomic DNA No translation available.
AC114773 Genomic DNA No translation available.
AL832851 mRNA Translation: CAI46157.2
BC034001 mRNA Translation: AAH34001.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47085.1 [P58335-4]
CCDS47086.1 [P58335-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001139266.1, NM_001145794.1 [P58335-1]
NP_001273709.1, NM_001286780.1
NP_001273710.1, NM_001286781.1
NP_477520.2, NM_058172.5 [P58335-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000307333; ENSP00000306185; ENSG00000163297 [P58335-1]
ENST00000346652; ENSP00000314883; ENSG00000163297 [P58335-2]
ENST00000403729; ENSP00000385575; ENSG00000163297 [P58335-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
118429

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:118429

UCSC genome browser

More...
UCSCi
uc003hly.5 human [P58335-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY040326 mRNA Translation: AAK77222.1
AY233452 mRNA Translation: AAP04016.1
AK055636 mRNA Translation: BAB70976.1 Different initiation.
AK091721 mRNA Translation: BAC03731.1
AB209913 mRNA Translation: BAD93150.1 Different initiation.
AC097711 Genomic DNA Translation: AAY40907.1 Sequence problems.
AC109518 Genomic DNA No translation available.
AC114773 Genomic DNA No translation available.
AL832851 mRNA Translation: CAI46157.2
BC034001 mRNA Translation: AAH34001.2
CCDSiCCDS47085.1 [P58335-4]
CCDS47086.1 [P58335-1]
RefSeqiNP_001139266.1, NM_001145794.1 [P58335-1]
NP_001273709.1, NM_001286780.1
NP_001273710.1, NM_001286781.1
NP_477520.2, NM_058172.5 [P58335-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1SHTX-ray1.81X38-217[»]
1SHUX-ray1.50X38-218[»]
1T6BX-ray2.50Y40-212[»]
1TZNX-ray4.30a/b/c/d/e/f/g/h/i/j/k/l/m/o38-218[»]
SMRiP58335
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125602, 12 interactors
DIPiDIP-32476N
IntActiP58335, 4 interactors
MINTiP58335
STRINGi9606.ENSP00000306185

PTM databases

iPTMnetiP58335
PhosphoSitePlusiP58335
SwissPalmiP58335

Polymorphism and mutation databases

BioMutaiANTXR2
DMDMi306526289

Proteomic databases

EPDiP58335
jPOSTiP58335
MaxQBiP58335
PaxDbiP58335
PeptideAtlasiP58335
PRIDEiP58335
ProteomicsDBi57060
57061 [P58335-2]
57062 [P58335-3]
57063 [P58335-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000307333; ENSP00000306185; ENSG00000163297 [P58335-1]
ENST00000346652; ENSP00000314883; ENSG00000163297 [P58335-2]
ENST00000403729; ENSP00000385575; ENSG00000163297 [P58335-4]
GeneIDi118429
KEGGihsa:118429
UCSCiuc003hly.5 human [P58335-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
118429
DisGeNETi118429

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ANTXR2
GeneReviewsiANTXR2
HGNCiHGNC:21732 ANTXR2
MalaCardsiANTXR2
MIMi228600 phenotype
608041 gene
neXtProtiNX_P58335
OpenTargetsiENSG00000163297
Orphaneti2176 Infantile systemic hyalinosis
2028 Juvenile hyaline fibromatosis
PharmGKBiPA128394752

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IK1W Eukaryota
ENOG410YC57 LUCA
GeneTreeiENSGT00940000156320
InParanoidiP58335
KOiK20909
OMAiLMRPQQG
OrthoDBi1546359at2759
PhylomeDBiP58335
TreeFamiTF328943

Enzyme and pathway databases

ReactomeiR-HSA-5210891 Uptake and function of anthrax toxins

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ANTXR2 human
EvolutionaryTraceiP58335

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ANTXR2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
118429

Protein Ontology

More...
PROi
PR:P58335

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000163297 Expressed in 192 organ(s), highest expression level in layer of synovial tissue
ExpressionAtlasiP58335 baseline and differential
GenevisibleiP58335 HS

Family and domain databases

Gene3Di3.40.50.410, 1 hit
InterProiView protein in InterPro
IPR017360 Anthrax_toxin_rcpt
IPR008399 Anthrax_toxin_rcpt_C
IPR008400 Anthrax_toxin_rcpt_extracel
IPR002035 VWF_A
IPR036465 vWFA_dom_sf
PANTHERiPTHR16059:SF13 PTHR16059:SF13, 1 hit
PfamiView protein in Pfam
PF05586 Ant_C, 1 hit
PF05587 Anth_Ig, 1 hit
PF00092 VWA, 1 hit
PIRSFiPIRSF038023 Anthrax_toxin_receptor_2, 1 hit
ProDomiView protein in ProDom or Entries sharing at least one domain
PD377005 Anthrax_toxin_rcpt_C, 1 hit
SMARTiView protein in SMART
SM00327 VWA, 1 hit
SUPFAMiSSF53300 SSF53300, 1 hit
PROSITEiView protein in PROSITE
PS50234 VWFA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiANTR2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P58335
Secondary accession number(s): Q4W5H6
, Q59E98, Q5JPE9, Q86UI1, Q8N4J8, Q8NB13, Q96NC7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 2, 2001
Last sequence update: October 5, 2010
Last modified: May 8, 2019
This is version 178 of the entry and version 5 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again