Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear pore complex protein Nup107

Gene

NUP107

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Plays a role in the nuclear pore complex (NPC) assembly and/or maintenance (PubMed:12552102, PubMed:15229283). Required for the assembly of peripheral proteins into the NPC (PubMed:15229283, PubMed:12552102). May anchor NUP62 to the NPC (PubMed:15229283).2 Publications

GO - Molecular functioni

  • structural constituent of nuclear pore Source: UniProtKB

GO - Biological processi

  • female gonad development Source: UniProtKB
  • mRNA export from nucleus Source: UniProtKB
  • nuclear pore complex assembly Source: UniProtKB
  • posttranscriptional tethering of RNA polymerase II gene DNA at nuclear periphery Source: GO_Central
  • protein import into nucleus Source: GO_Central
  • regulation of transcription, DNA-templated Source: GO_Central
  • viral process Source: Reactome

Keywordsi

Biological processmRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

ReactomeiR-HSA-1169408 ISG15 antiviral mechanism
R-HSA-141444 Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-159227 Transport of the SLBP independent Mature mRNA
R-HSA-159230 Transport of the SLBP Dependant Mature mRNA
R-HSA-159231 Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-165054 Rev-mediated nuclear export of HIV RNA
R-HSA-168271 Transport of Ribonucleoproteins into the Host Nucleus
R-HSA-168276 NS1 Mediated Effects on Host Pathways
R-HSA-168325 Viral Messenger RNA Synthesis
R-HSA-168333 NEP/NS2 Interacts with the Cellular Export Machinery
R-HSA-170822 Regulation of Glucokinase by Glucokinase Regulatory Protein
R-HSA-180746 Nuclear import of Rev protein
R-HSA-180910 Vpr-mediated nuclear import of PICs
R-HSA-191859 snRNP Assembly
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2500257 Resolution of Sister Chromatid Cohesion
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-3301854 Nuclear Pore Complex (NPC) Disassembly
R-HSA-3371453 Regulation of HSF1-mediated heat shock response
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-4570464 SUMOylation of RNA binding proteins
R-HSA-4615885 SUMOylation of DNA replication proteins
R-HSA-5578749 Transcriptional regulation by small RNAs
R-HSA-5663220 RHO GTPases Activate Formins
R-HSA-6784531 tRNA processing in the nucleus
R-HSA-68877 Mitotic Prometaphase

Protein family/group databases

TCDBi1.I.1.1.3 the eukaryotic nuclear pore complex (e-npc) family

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear pore complex protein Nup107
Alternative name(s):
107 kDa nucleoporin
Nucleoporin Nup107
Gene namesi
Name:NUP107
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000111581.9
HGNCiHGNC:29914 NUP107
MIMi607617 gene
neXtProtiNX_P57740

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Membrane, Nuclear pore complex, Nucleus

Pathology & Biotechi

Involvement in diseasei

Nephrotic syndrome 11 (NPHS11)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of nephrotic syndrome, a renal disease clinically characterized by severe proteinuria, resulting in complications such as hypoalbuminemia, hyperlipidemia and edema. Kidney biopsies show non-specific histologic changes such as focal segmental glomerulosclerosis and diffuse mesangial proliferation. Some affected individuals have an inherited steroid-resistant form and progress to end-stage renal failure. NPHS11 is an autosomal recessive, steroid-resistant and progressive form with onset in the first decade of life.
See also OMIM:616730
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_076358157D → Y in NPHS11; no effect on interaction with NUP133; no effect on localization to the nuclear pore. 1 PublicationCorresponds to variant dbSNP:rs864321633EnsemblClinVar.1
Natural variantiVAR_076359831D → A in NPHS11; decreased interaction with NUP133; changed localization to the nuclear pore with relocalization to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs864321632EnsemblClinVar.1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNETi57122
MalaCardsiNUP107
MIMi616730 phenotype
OpenTargetsiENSG00000111581
PharmGKBiPA134890486

Polymorphism and mutation databases

BioMutaiNUP107
DMDMi12230339

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002048311 – 925Nuclear pore complex protein Nup107Add BLAST925

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei4PhosphoserineCombined sources1
Modified residuei10PhosphoserineCombined sources1
Modified residuei11PhosphoserineCombined sources1
Modified residuei37PhosphoserineCombined sources1
Modified residuei46PhosphothreonineCombined sources1
Modified residuei55PhosphothreonineCombined sources1
Modified residuei57PhosphoserineCombined sources1
Modified residuei58PhosphoserineCombined sources1
Modified residuei60Asymmetric dimethylarginine; alternateBy similarity1
Modified residuei60Omega-N-methylarginine; alternateCombined sources1
Modified residuei64PhosphothreonineCombined sources1
Modified residuei68Omega-N-methylarginineBy similarity1
Modified residuei69PhosphoserineCombined sources1
Modified residuei86PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Methylation, Phosphoprotein

Proteomic databases

EPDiP57740
MaxQBiP57740
PaxDbiP57740
PeptideAtlasiP57740
PRIDEiP57740
ProteomicsDBi57028

PTM databases

iPTMnetiP57740
PhosphoSitePlusiP57740
SwissPalmiP57740

Expressioni

Tissue specificityi

Ubiquitously expressed in fetal and adult tissues.1 Publication

Gene expression databases

BgeeiENSG00000111581
CleanExiHS_NUP107
ExpressionAtlasiP57740 baseline and differential
GenevisibleiP57740 HS

Organism-specific databases

HPAiHPA031679

Interactioni

Subunit structurei

Part of the nuclear pore complex (NPC) (PubMed:11564755, PubMed:12802065, PubMed:15229283, PubMed:26411495). Forms part of the Nup160 subcomplex in the nuclear pore which is composed of NUP160, NUP133, NUP107 and Nup96; this complex plays a role in RNA export and in tethering Nup98 and NUP153 to the nucleus (PubMed:11564755, PubMed:11684705, PubMed:26411495). Does not interact with TPR (PubMed:12802065).5 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
NUP133Q8WUM011EBI-295687,EBI-295695

Protein-protein interaction databases

BioGridi121386, 109 interactors
CORUMiP57740
IntActiP57740, 87 interactors
MINTiP57740
STRINGi9606.ENSP00000229179

Structurei

Secondary structure

1925
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi668 – 680Combined sources13
Helixi682 – 684Combined sources3
Helixi685 – 701Combined sources17
Helixi705 – 714Combined sources10
Helixi719 – 723Combined sources5
Helixi738 – 767Combined sources30
Helixi782 – 821Combined sources40
Turni824 – 826Combined sources3
Helixi840 – 867Combined sources28
Helixi871 – 875Combined sources5
Helixi877 – 882Combined sources6
Turni884 – 886Combined sources3
Helixi888 – 891Combined sources4
Helixi894 – 912Combined sources19
Turni913 – 915Combined sources3

3D structure databases

ProteinModelPortaliP57740
SMRiP57740
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP57740

Family & Domainsi

Sequence similaritiesi

Belongs to the nucleoporin Nup84/Nup107 family.Curated

Phylogenomic databases

eggNOGiKOG1964 Eukaryota
ENOG410XRUG LUCA
GeneTreeiENSGT00390000012080
HOGENOMiHOG000006750
HOVERGENiHBG052677
InParanoidiP57740
KOiK14301
OMAiKVQIDIR
OrthoDBiEOG091G02HY
PhylomeDBiP57740
TreeFamiTF324259

Family and domain databases

InterProiView protein in InterPro
IPR007252 Nup84/Nup107
PANTHERiPTHR13003 PTHR13003, 1 hit
PfamiView protein in Pfam
PF04121 Nup84_Nup100, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P57740-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDRSGFGEIS SPVIREAEVT RTARKQSAQK RVLLQASQDE NFGNTTPRNQ
60 70 80 90 100
VIPRTPSSFR QPFTPTSRSL LRQPDISCIL GTGGKSPRLT QSSGFFGNLS
110 120 130 140 150
MVTNLDDSNW AAAFSSQRSG LFTNTEPHSI TEDVTISAVM LREDDPGEAA
160 170 180 190 200
SMSMFSDFLQ SFLKHSSSTV FDLVEEYENI CGSQVNILSK IVSRATPGLQ
210 220 230 240 250
KFSKTASMLW LLQQEMVTWR LLASLYRDRI QSALEEESVF AVTAVNASEK
260 270 280 290 300
TVVEALFQRD SLVRQSQLVV DWLESIAKDE IGEFSDNIEF YAKSVYWENT
310 320 330 340 350
LHTLKQRQLT SYVGSVRPLV TELDPDAPIR QKMPLDDLDR EDEVRLLKYL
360 370 380 390 400
FTLIRAGMTE EAQRLCKRCG QAWRAATLEG WKLYHDPNVN GGTELEPVEG
410 420 430 440 450
NPYRRIWKIS CWRMAEDELF NRYERAIYAA LSGNLKQLLP VCDTWEDTVW
460 470 480 490 500
AYFRVMVDSL VEQEIQTSVA TLDETEELPR EYLGANWTLE KVFEELQATD
510 520 530 540 550
KKRVLEENQE HYHIVQKFLI LGDIDGLMDE FSKWLSKSRN NLPGHLLRFM
560 570 580 590 600
THLILFFRTL GLQTKEEVSI EVLKTYIQLL IREKHTNLIA FYTCHLPQDL
610 620 630 640 650
AVAQYALFLE SVTEFEQRHH CLELAKEADL DVATITKTVV ENIRKKDNGE
660 670 680 690 700
FSHHDLAPAL DTGTTEEDRL KIDVIDWLVF DPAQRAEALK QGNAIMRKFL
710 720 730 740 750
ASKKHEAAKE VFVKIPQDSI AEIYNQCEEQ GMESPLPAED DNAIREHLCI
760 770 780 790 800
RAYLEAHETF NEWFKHMNSV PQKPALIPQP TFTEKVAHEH KEKKYEMDFG
810 820 830 840 850
IWKGHLDALT ADVKEKMYNV LLFVDGGWMV DVREDAKEDH ERTHQMVLLR
860 870 880 890 900
KLCLPMLCFL LHTILHSTGQ YQECLQLADM VSSERHKLYL VFSKEELRKL
910 920
LQKLRESSLM LLDQGLDPLG YEIQL
Length:925
Mass (Da):106,374
Last modified:January 11, 2001 - v1
Checksum:iCE1E4DA6C832A5A5
GO
Isoform 2 (identifier: P57740-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-63: MDRSGFGEIS...RTPSSFRQPF → MKILVILHQETRLSLELLAHFDSLVLSTNLLFIV

Note: No experimental confirmation available.
Show »
Length:896
Mass (Da):103,175
Checksum:i5F39C26B982CE197
GO
Isoform 3 (identifier: P57740-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-151: Missing.
     579-666: Missing.

Note: No experimental confirmation available.
Show »
Length:686
Mass (Da):79,971
Checksum:iBC61E0588F57AA4B
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti845Q → R in AAH43343 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_076358157D → Y in NPHS11; no effect on interaction with NUP133; no effect on localization to the nuclear pore. 1 PublicationCorresponds to variant dbSNP:rs864321633EnsemblClinVar.1
Natural variantiVAR_078571447D → N Found in a family with 46,XX ovarian dysgenesis; unknown pathological significance. 1 Publication1
Natural variantiVAR_076359831D → A in NPHS11; decreased interaction with NUP133; changed localization to the nuclear pore with relocalization to the cytoplasm. 1 PublicationCorresponds to variant dbSNP:rs864321632EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0542621 – 151Missing in isoform 3. 1 PublicationAdd BLAST151
Alternative sequenceiVSP_0542631 – 63MDRSG…FRQPF → MKILVILHQETRLSLELLAH FDSLVLSTNLLFIV in isoform 2. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_054264579 – 666Missing in isoform 3. 1 PublicationAdd BLAST88

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ295745 mRNA Translation: CAC03716.1
AK302773 mRNA Translation: BAG63979.1
AC090061 Genomic DNA No translation available.
AC124890 Genomic DNA No translation available.
BC017167 mRNA Translation: AAH17167.1
BC043343 mRNA Translation: AAH43343.1
CCDSiCCDS81712.1 [P57740-2]
CCDS8985.1 [P57740-1]
RefSeqiNP_001317121.1, NM_001330192.1 [P57740-2]
NP_065134.1, NM_020401.3 [P57740-1]
UniGeneiHs.524574
Hs.587722

Genome annotation databases

EnsembliENST00000229179; ENSP00000229179; ENSG00000111581 [P57740-1]
ENST00000378905; ENSP00000368185; ENSG00000111581 [P57740-3]
ENST00000539906; ENSP00000441448; ENSG00000111581 [P57740-2]
GeneIDi57122
KEGGihsa:57122
UCSCiuc001suf.4 human [P57740-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNU107_HUMAN
AccessioniPrimary (citable) accession number: P57740
Secondary accession number(s): B4DZ67, Q6PJE1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: January 11, 2001
Last modified: July 18, 2018
This is version 164 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health