Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 164 (18 Sep 2019)
Sequence version 1 (01 Dec 2000)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ubiquitin-associated and SH3 domain-containing protein A

Gene

UBASH3A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface. Exhibits negligigle protein tyrosine phosphatase activity at neutral pH. May act as a dominant-negative regulator of UBASH3B-dependent dephosphorylation. May inhibit dynamin-dependent endocytic pathways by functionally sequestering dynamin via its SH3 domain.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P57075

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ubiquitin-associated and SH3 domain-containing protein A
Alternative name(s):
Cbl-interacting protein 4
Short name:
CLIP4
Suppressor of T-cell receptor signaling 2
Short name:
STS-2
T-cell ubiquitin ligand 1
Short name:
TULA-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UBASH3A
Synonyms:STS2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 21

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:12462 UBASH3A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
605736 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P57075

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi317W → A: Loss of interaction with CBL. 2 Publications1
Mutagenesisi317W → L: Abolishes binding to dynamin. 2 Publications1

Organism-specific databases

DisGeNET

More...
DisGeNETi
53347

Open Targets

More...
OpenTargetsi
ENSG00000160185

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37112

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UBASH3A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
10720330

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002109941 – 661Ubiquitin-associated and SH3 domain-containing protein AAdd BLAST661

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P57075

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P57075

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P57075

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P57075

PeptideAtlas

More...
PeptideAtlasi
P57075

PRoteomics IDEntifications database

More...
PRIDEi
P57075

ProteomicsDB human proteome resource

More...
ProteomicsDBi
33914
56982 [P57075-1]
56983 [P57075-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P57075

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P57075

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest expression of UBASH3A in tissues belonging to the immune system, including spleen, peripheral blood leukocytes, thymus and bone marrow.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000160185 Expressed in 81 organ(s), highest expression level in leukocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P57075 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P57075 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA035367

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer or homooligomer.

Interacts with CBL.

Part of a complex containing CBL and activated EGFR.

Interacts with ubiquitin and with mono-ubiquitinated proteins.

Interacts with dynamin.

3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119748, 26 interactors

Protein interaction database and analysis system

More...
IntActi
P57075, 83 interactors

Molecular INTeraction database

More...
MINTi
P57075

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000317327

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1661
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P57075

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P57075

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini15 – 60UBAPROSITE-ProRule annotationAdd BLAST46
Domaini276 – 341SH3PROSITE-ProRule annotationAdd BLAST66

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni395 – 661Phosphatase-likeAdd BLAST267

Keywords - Domaini

SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IN2Z Eukaryota
ENOG410YCFH LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160841

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000012936

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P57075

KEGG Orthology (KO)

More...
KOi
K18993

Identification of Orthologs from Complete Genome Data

More...
OMAi
HRTYTFS

Database of Orthologous Groups

More...
OrthoDBi
243749at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P57075

TreeFam database of animal gene trees

More...
TreeFami
TF313334

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07067 HP_PGM_like, 1 hit
cd11937 SH3_UBASH3A, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.1240, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013078 His_Pase_superF_clade-1
IPR029033 His_PPase_superfam
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR015940 UBA
IPR009060 UBA-like_sf
IPR035634 UBASH3A_SH3

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00300 His_Phos_1, 1 hit
PF14604 SH3_9, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46934 SSF46934, 1 hit
SSF50044 SSF50044, 1 hit
SSF53254 SSF53254, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002 SH3, 1 hit
PS50030 UBA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P57075-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAGETQLYA KVSNKLKSRS SPSLLEPLLA MGFPVHTALK ALAATGRKTA
60 70 80 90 100
EEALAWLHDH CNDPSLDDPI PQEYALFLCP TGPLLEKLQE FWRESKRQCA
110 120 130 140 150
KNRAHEVFPH VTLCDFFTCE DQKVECLYEA LKRAGDRLLG SFPTAVPLAL
160 170 180 190 200
HSSISYLGFF VSGSPADVIR EFAMTFATEA SLLAGTSVSR FWIFSQVPGH
210 220 230 240 250
GPNLRLSNLT RASFVSHYIL QKYCSVKPCT KQLHLTLAHK FYPHHQRTLE
260 270 280 290 300
QLARAIPLGH SCQWTAALYS RDMRFVHYQT LRALFQYKPQ NVDELTLSPG
310 320 330 340 350
DYIFVDPTQQ DEASEGWVIG ISQRTGCRGF LPENYTDRAS ESDTWVKHRM
360 370 380 390 400
YTFSLATDLN SRKDGEASSR CSGEFLPQTA RSLSSLQALQ ATVARKSVLV
410 420 430 440 450
VRHGERVDQI FGKAWLQQCS TPDGKYYRPD LNFPCSLPRR SRGIKDFEND
460 470 480 490 500
PPLSSCGIFQ SRIAGDALLD SGIRISSVFA SPALRCVQTA KLILEELKLE
510 520 530 540 550
KKIKIRVEPG IFEWTKWEAG KTTPTLMSLE ELKEANFNID TDYRPAFPLS
560 570 580 590 600
ALMPAESYQE YMDRCTASMV QIVNTCPQDT GVILIVSHGS TLDSCTRPLL
610 620 630 640 650
GLPPRECGDF AQLVRKIPSL GMCFCEENKE EGKWELVNPP VKTLTHGANA
660
AFNWRNWISG N
Length:661
Mass (Da):74,123
Last modified:December 1, 2000 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i60DA2E0B8CE4ABFC
GO
Isoform 2 (identifier: P57075-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     185-223: GTSVSRFWIFSQVPGHGPNLRLSNLTRASFVSHYILQKY → D

Show »
Length:623
Mass (Da):69,791
Checksum:iE5AA549B7D3C915E
GO
Isoform 3 (identifier: P57075-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-223: GTSVSRFWIFSQVPGHGPNLRLSNLTRASFVSHYILQKY → D
     545-564: PAFPLSALMPAESYQEYMDR → SLPWACASVKKIKRKENGSW
     565-661: Missing.

Note: No experimental confirmation available.
Show »
Length:526
Mass (Da):59,167
Checksum:iB0E4C315A85B42FF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RQY9A0A0U1RQY9_HUMAN
Ubiquitin associated and SH3 domain...
UBASH3A hCG_401269
451Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RRC9A0A0U1RRC9_HUMAN
Ubiquitin-associated and SH3 domain...
UBASH3A
521Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RQL4A0A0U1RQL4_HUMAN
Ubiquitin-associated and SH3 domain...
UBASH3A
169Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RR03A0A0U1RR03_HUMAN
Ubiquitin-associated and SH3 domain...
UBASH3A
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RR38A0A0U1RR38_HUMAN
Ubiquitin-associated and SH3 domain...
UBASH3A
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti64P → H in AAH69511 (PubMed:15489334).Curated1
Sequence conflicti129E → K in BC069577 (PubMed:15489334).Curated1
Sequence conflicti229C → Y in AAH69511 (PubMed:15489334).Curated1
Sequence conflicti283A → V in AAH69483 (PubMed:15489334).Curated1
Sequence conflicti393V → I in AAH69511 (PubMed:15489334).Curated1
Sequence conflicti651A → V in AAH69511 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_02697118S → G1 PublicationCorresponds to variant dbSNP:rs2277798Ensembl.1
Natural variantiVAR_02697228L → F1 PublicationCorresponds to variant dbSNP:rs2277800Ensembl.1
Natural variantiVAR_026973286Q → R. Corresponds to variant dbSNP:rs775952011Ensembl.1
Natural variantiVAR_061921324R → L. Corresponds to variant dbSNP:rs13048049Ensembl.1
Natural variantiVAR_061922324R → Q. Corresponds to variant dbSNP:rs13048049Ensembl.1
Natural variantiVAR_052675466D → E. Corresponds to variant dbSNP:rs17114930Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_006703185 – 223GTSVS…ILQKY → D in isoform 2 and isoform 3. 3 PublicationsAdd BLAST39
Alternative sequenceiVSP_045549545 – 564PAFPL…EYMDR → SLPWACASVKKIKRKENGSW in isoform 3. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_045550565 – 661Missing in isoform 3. 1 PublicationAdd BLAST97

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AJ277750 mRNA Translation: CAB91543.1
AF520809 mRNA Translation: AAP80731.1
AF521702 mRNA Translation: AAP80738.1
AP001746 Genomic DNA No translation available.
CH471079 Genomic DNA Translation: EAX09560.1
BC069357 mRNA Translation: AAH69357.1
BC069483 mRNA Translation: AAH69483.1
BC069511 mRNA Translation: AAH69511.1
BC069577 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13687.1 [P57075-1]
CCDS33566.1 [P57075-2]
CCDS58791.1 [P57075-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001001895.1, NM_001001895.2 [P57075-2]
NP_001230396.1, NM_001243467.1 [P57075-3]
NP_061834.1, NM_018961.3 [P57075-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000291535; ENSP00000291535; ENSG00000160185 [P57075-2]
ENST00000319294; ENSP00000317327; ENSG00000160185 [P57075-1]
ENST00000398367; ENSP00000381408; ENSG00000160185 [P57075-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
53347

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:53347

UCSC genome browser

More...
UCSCi
uc002zbe.4 human [P57075-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ277750 mRNA Translation: CAB91543.1
AF520809 mRNA Translation: AAP80731.1
AF521702 mRNA Translation: AAP80738.1
AP001746 Genomic DNA No translation available.
CH471079 Genomic DNA Translation: EAX09560.1
BC069357 mRNA Translation: AAH69357.1
BC069483 mRNA Translation: AAH69483.1
BC069511 mRNA Translation: AAH69511.1
BC069577 mRNA No translation available.
CCDSiCCDS13687.1 [P57075-1]
CCDS33566.1 [P57075-2]
CCDS58791.1 [P57075-3]
RefSeqiNP_001001895.1, NM_001001895.2 [P57075-2]
NP_001230396.1, NM_001243467.1 [P57075-3]
NP_061834.1, NM_018961.3 [P57075-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CRNNMR-A20-70[»]
5WDIX-ray2.43A/B394-658[»]
SMRiP57075
ModBaseiSearch...

Protein-protein interaction databases

BioGridi119748, 26 interactors
IntActiP57075, 83 interactors
MINTiP57075
STRINGi9606.ENSP00000317327

PTM databases

iPTMnetiP57075
PhosphoSitePlusiP57075

Polymorphism and mutation databases

BioMutaiUBASH3A
DMDMi10720330

Proteomic databases

jPOSTiP57075
MassIVEiP57075
MaxQBiP57075
PaxDbiP57075
PeptideAtlasiP57075
PRIDEiP57075
ProteomicsDBi33914
56982 [P57075-1]
56983 [P57075-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000291535; ENSP00000291535; ENSG00000160185 [P57075-2]
ENST00000319294; ENSP00000317327; ENSG00000160185 [P57075-1]
ENST00000398367; ENSP00000381408; ENSG00000160185 [P57075-3]
GeneIDi53347
KEGGihsa:53347
UCSCiuc002zbe.4 human [P57075-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
53347
DisGeNETi53347

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UBASH3A
HGNCiHGNC:12462 UBASH3A
HPAiHPA035367
MIMi605736 gene
neXtProtiNX_P57075
OpenTargetsiENSG00000160185
PharmGKBiPA37112

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IN2Z Eukaryota
ENOG410YCFH LUCA
GeneTreeiENSGT00940000160841
HOGENOMiHOG000012936
InParanoidiP57075
KOiK18993
OMAiHRTYTFS
OrthoDBi243749at2759
PhylomeDBiP57075
TreeFamiTF313334

Enzyme and pathway databases

SignaLinkiP57075

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UBASH3A human
EvolutionaryTraceiP57075

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
UBASH3A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
53347

Pharos

More...
Pharosi
P57075

Protein Ontology

More...
PROi
PR:P57075

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000160185 Expressed in 81 organ(s), highest expression level in leukocyte
ExpressionAtlasiP57075 baseline and differential
GenevisibleiP57075 HS

Family and domain databases

CDDicd07067 HP_PGM_like, 1 hit
cd11937 SH3_UBASH3A, 1 hit
Gene3Di3.40.50.1240, 1 hit
InterProiView protein in InterPro
IPR013078 His_Pase_superF_clade-1
IPR029033 His_PPase_superfam
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR015940 UBA
IPR009060 UBA-like_sf
IPR035634 UBASH3A_SH3
PfamiView protein in Pfam
PF00300 His_Phos_1, 1 hit
PF14604 SH3_9, 1 hit
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF46934 SSF46934, 1 hit
SSF50044 SSF50044, 1 hit
SSF53254 SSF53254, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit
PS50030 UBA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUBS3A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P57075
Secondary accession number(s): G5E9E4
, Q6HA34, Q6HA35, Q6ISI6, Q6ISK3, Q6ISS9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: December 1, 2000
Last modified: September 18, 2019
This is version 164 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again