Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin-associated and SH3 domain-containing protein A

Gene

UBASH3A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Interferes with CBL-mediated down-regulation and degradation of receptor-type tyrosine kinases. Promotes accumulation of activated target receptors, such as T-cell receptors, EGFR and PDGFRB, on the cell surface. Exhibits negligigle protein tyrosine phosphatase activity at neutral pH. May act as a dominant-negative regulator of UBASH3B-dependent dephosphorylation. May inhibit dynamin-dependent endocytic pathways by functionally sequestering dynamin via its SH3 domain.3 Publications

GO - Molecular functioni

  • phosphatase activity Source: GO_Central

GO - Biological processi

Enzyme and pathway databases

SignaLinkiP57075

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin-associated and SH3 domain-containing protein A
Alternative name(s):
Cbl-interacting protein 4
Short name:
CLIP4
Suppressor of T-cell receptor signaling 2
Short name:
STS-2
T-cell ubiquitin ligand 1
Short name:
TULA-1
Gene namesi
Name:UBASH3A
Synonyms:STS2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 21

Organism-specific databases

EuPathDBiHostDB:ENSG00000160185.14
HGNCiHGNC:12462 UBASH3A
MIMi605736 gene
neXtProtiNX_P57075

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi317W → A: Loss of interaction with CBL. 2 Publications1
Mutagenesisi317W → L: Abolishes binding to dynamin. 2 Publications1

Organism-specific databases

DisGeNETi53347
OpenTargetsiENSG00000160185
PharmGKBiPA37112

Polymorphism and mutation databases

BioMutaiUBASH3A
DMDMi10720330

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002109941 – 661Ubiquitin-associated and SH3 domain-containing protein AAdd BLAST661

Proteomic databases

MaxQBiP57075
PaxDbiP57075
PeptideAtlasiP57075
PRIDEiP57075
ProteomicsDBi56982
56983 [P57075-2]

PTM databases

iPTMnetiP57075
PhosphoSitePlusiP57075

Expressioni

Tissue specificityi

Highest expression of UBASH3A in tissues belonging to the immune system, including spleen, peripheral blood leukocytes, thymus and bone marrow.2 Publications

Gene expression databases

BgeeiENSG00000160185 Expressed in 81 organ(s), highest expression level in leukocyte
CleanExiHS_UBASH3A
ExpressionAtlasiP57075 baseline and differential
GenevisibleiP57075 HS

Organism-specific databases

HPAiHPA035367

Interactioni

Subunit structurei

Homodimer or homooligomer. Interacts with CBL. Part of a complex containing CBL and activated EGFR. Interacts with ubiquitin and with mono-ubiquitinated proteins. Interacts with dynamin.3 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi119748, 23 interactors
IntActiP57075, 83 interactors
MINTiP57075
STRINGi9606.ENSP00000317327

Structurei

Secondary structure

1661
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP57075
SMRiP57075
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP57075

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini15 – 60UBAPROSITE-ProRule annotationAdd BLAST46
Domaini276 – 341SH3PROSITE-ProRule annotationAdd BLAST66

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni395 – 661Phosphatase-likeAdd BLAST267

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiENOG410IN2Z Eukaryota
ENOG410YCFH LUCA
GeneTreeiENSGT00390000018249
HOGENOMiHOG000012936
HOVERGENiHBG018025
InParanoidiP57075
KOiK18993
OMAiHRTYTFS
OrthoDBiEOG091G0DJ2
PhylomeDBiP57075
TreeFamiTF313334

Family and domain databases

CDDicd07067 HP_PGM_like, 1 hit
cd11937 SH3_UBASH3A, 1 hit
Gene3Di3.40.50.1240, 1 hit
InterProiView protein in InterPro
IPR013078 His_Pase_superF_clade-1
IPR029033 His_PPase_superfam
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR015940 UBA
IPR009060 UBA-like_sf
IPR035634 UBASH3A_SH3
PfamiView protein in Pfam
PF00300 His_Phos_1, 1 hit
PF14604 SH3_9, 1 hit
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF46934 SSF46934, 1 hit
SSF50044 SSF50044, 1 hit
SSF53254 SSF53254, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit
PS50030 UBA, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P57075-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAGETQLYA KVSNKLKSRS SPSLLEPLLA MGFPVHTALK ALAATGRKTA
60 70 80 90 100
EEALAWLHDH CNDPSLDDPI PQEYALFLCP TGPLLEKLQE FWRESKRQCA
110 120 130 140 150
KNRAHEVFPH VTLCDFFTCE DQKVECLYEA LKRAGDRLLG SFPTAVPLAL
160 170 180 190 200
HSSISYLGFF VSGSPADVIR EFAMTFATEA SLLAGTSVSR FWIFSQVPGH
210 220 230 240 250
GPNLRLSNLT RASFVSHYIL QKYCSVKPCT KQLHLTLAHK FYPHHQRTLE
260 270 280 290 300
QLARAIPLGH SCQWTAALYS RDMRFVHYQT LRALFQYKPQ NVDELTLSPG
310 320 330 340 350
DYIFVDPTQQ DEASEGWVIG ISQRTGCRGF LPENYTDRAS ESDTWVKHRM
360 370 380 390 400
YTFSLATDLN SRKDGEASSR CSGEFLPQTA RSLSSLQALQ ATVARKSVLV
410 420 430 440 450
VRHGERVDQI FGKAWLQQCS TPDGKYYRPD LNFPCSLPRR SRGIKDFEND
460 470 480 490 500
PPLSSCGIFQ SRIAGDALLD SGIRISSVFA SPALRCVQTA KLILEELKLE
510 520 530 540 550
KKIKIRVEPG IFEWTKWEAG KTTPTLMSLE ELKEANFNID TDYRPAFPLS
560 570 580 590 600
ALMPAESYQE YMDRCTASMV QIVNTCPQDT GVILIVSHGS TLDSCTRPLL
610 620 630 640 650
GLPPRECGDF AQLVRKIPSL GMCFCEENKE EGKWELVNPP VKTLTHGANA
660
AFNWRNWISG N
Length:661
Mass (Da):74,123
Last modified:December 1, 2000 - v1
Checksum:i60DA2E0B8CE4ABFC
GO
Isoform 2 (identifier: P57075-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     185-223: GTSVSRFWIFSQVPGHGPNLRLSNLTRASFVSHYILQKY → D

Show »
Length:623
Mass (Da):69,791
Checksum:iE5AA549B7D3C915E
GO
Isoform 3 (identifier: P57075-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     185-223: GTSVSRFWIFSQVPGHGPNLRLSNLTRASFVSHYILQKY → D
     545-564: PAFPLSALMPAESYQEYMDR → SLPWACASVKKIKRKENGSW
     565-661: Missing.

Note: No experimental confirmation available.
Show »
Length:526
Mass (Da):59,167
Checksum:iB0E4C315A85B42FF
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RQY9A0A0U1RQY9_HUMAN
Ubiquitin associated and SH3 domain...
UBASH3A hCG_401269
451Annotation score:
A0A0U1RRC9A0A0U1RRC9_HUMAN
Ubiquitin-associated and SH3 domain...
UBASH3A
521Annotation score:
A0A0U1RQL4A0A0U1RQL4_HUMAN
Ubiquitin-associated and SH3 domain...
UBASH3A
169Annotation score:
A0A0U1RR03A0A0U1RR03_HUMAN
Ubiquitin-associated and SH3 domain...
UBASH3A
55Annotation score:
A0A0U1RR38A0A0U1RR38_HUMAN
Ubiquitin-associated and SH3 domain...
UBASH3A
38Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti64P → H in AAH69511 (PubMed:15489334).Curated1
Sequence conflicti129E → K in BC069577 (PubMed:15489334).Curated1
Sequence conflicti229C → Y in AAH69511 (PubMed:15489334).Curated1
Sequence conflicti283A → V in AAH69483 (PubMed:15489334).Curated1
Sequence conflicti393V → I in AAH69511 (PubMed:15489334).Curated1
Sequence conflicti651A → V in AAH69511 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02697118S → G1 PublicationCorresponds to variant dbSNP:rs2277798Ensembl.1
Natural variantiVAR_02697228L → F1 PublicationCorresponds to variant dbSNP:rs2277800Ensembl.1
Natural variantiVAR_026973286Q → R. Corresponds to variant dbSNP:rs775952011Ensembl.1
Natural variantiVAR_061921324R → L. Corresponds to variant dbSNP:rs13048049Ensembl.1
Natural variantiVAR_061922324R → Q. Corresponds to variant dbSNP:rs13048049Ensembl.1
Natural variantiVAR_052675466D → E. Corresponds to variant dbSNP:rs17114930Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_006703185 – 223GTSVS…ILQKY → D in isoform 2 and isoform 3. 3 PublicationsAdd BLAST39
Alternative sequenceiVSP_045549545 – 564PAFPL…EYMDR → SLPWACASVKKIKRKENGSW in isoform 3. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_045550565 – 661Missing in isoform 3. 1 PublicationAdd BLAST97

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ277750 mRNA Translation: CAB91543.1
AF520809 mRNA Translation: AAP80731.1
AF521702 mRNA Translation: AAP80738.1
AP001746 Genomic DNA No translation available.
CH471079 Genomic DNA Translation: EAX09560.1
BC069357 mRNA Translation: AAH69357.1
BC069483 mRNA Translation: AAH69483.1
BC069511 mRNA Translation: AAH69511.1
BC069577 mRNA No translation available.
CCDSiCCDS13687.1 [P57075-1]
CCDS33566.1 [P57075-2]
CCDS58791.1 [P57075-3]
RefSeqiNP_001001895.1, NM_001001895.2 [P57075-2]
NP_001230396.1, NM_001243467.1 [P57075-3]
NP_061834.1, NM_018961.3 [P57075-1]
UniGeneiHs.473912

Genome annotation databases

EnsembliENST00000291535; ENSP00000291535; ENSG00000160185 [P57075-2]
ENST00000319294; ENSP00000317327; ENSG00000160185 [P57075-1]
ENST00000398367; ENSP00000381408; ENSG00000160185 [P57075-3]
GeneIDi53347
KEGGihsa:53347
UCSCiuc002zbe.4 human [P57075-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ277750 mRNA Translation: CAB91543.1
AF520809 mRNA Translation: AAP80731.1
AF521702 mRNA Translation: AAP80738.1
AP001746 Genomic DNA No translation available.
CH471079 Genomic DNA Translation: EAX09560.1
BC069357 mRNA Translation: AAH69357.1
BC069483 mRNA Translation: AAH69483.1
BC069511 mRNA Translation: AAH69511.1
BC069577 mRNA No translation available.
CCDSiCCDS13687.1 [P57075-1]
CCDS33566.1 [P57075-2]
CCDS58791.1 [P57075-3]
RefSeqiNP_001001895.1, NM_001001895.2 [P57075-2]
NP_001230396.1, NM_001243467.1 [P57075-3]
NP_061834.1, NM_018961.3 [P57075-1]
UniGeneiHs.473912

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2CRNNMR-A20-70[»]
5WDIX-ray2.43A/B394-658[»]
ProteinModelPortaliP57075
SMRiP57075
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119748, 23 interactors
IntActiP57075, 83 interactors
MINTiP57075
STRINGi9606.ENSP00000317327

PTM databases

iPTMnetiP57075
PhosphoSitePlusiP57075

Polymorphism and mutation databases

BioMutaiUBASH3A
DMDMi10720330

Proteomic databases

MaxQBiP57075
PaxDbiP57075
PeptideAtlasiP57075
PRIDEiP57075
ProteomicsDBi56982
56983 [P57075-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000291535; ENSP00000291535; ENSG00000160185 [P57075-2]
ENST00000319294; ENSP00000317327; ENSG00000160185 [P57075-1]
ENST00000398367; ENSP00000381408; ENSG00000160185 [P57075-3]
GeneIDi53347
KEGGihsa:53347
UCSCiuc002zbe.4 human [P57075-1]

Organism-specific databases

CTDi53347
DisGeNETi53347
EuPathDBiHostDB:ENSG00000160185.14
GeneCardsiUBASH3A
HGNCiHGNC:12462 UBASH3A
HPAiHPA035367
MIMi605736 gene
neXtProtiNX_P57075
OpenTargetsiENSG00000160185
PharmGKBiPA37112
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IN2Z Eukaryota
ENOG410YCFH LUCA
GeneTreeiENSGT00390000018249
HOGENOMiHOG000012936
HOVERGENiHBG018025
InParanoidiP57075
KOiK18993
OMAiHRTYTFS
OrthoDBiEOG091G0DJ2
PhylomeDBiP57075
TreeFamiTF313334

Enzyme and pathway databases

SignaLinkiP57075

Miscellaneous databases

ChiTaRSiUBASH3A human
EvolutionaryTraceiP57075
GeneWikiiUBASH3A
GenomeRNAii53347
PROiPR:P57075
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000160185 Expressed in 81 organ(s), highest expression level in leukocyte
CleanExiHS_UBASH3A
ExpressionAtlasiP57075 baseline and differential
GenevisibleiP57075 HS

Family and domain databases

CDDicd07067 HP_PGM_like, 1 hit
cd11937 SH3_UBASH3A, 1 hit
Gene3Di3.40.50.1240, 1 hit
InterProiView protein in InterPro
IPR013078 His_Pase_superF_clade-1
IPR029033 His_PPase_superfam
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR015940 UBA
IPR009060 UBA-like_sf
IPR035634 UBASH3A_SH3
PfamiView protein in Pfam
PF00300 His_Phos_1, 1 hit
PF14604 SH3_9, 1 hit
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF46934 SSF46934, 1 hit
SSF50044 SSF50044, 1 hit
SSF53254 SSF53254, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit
PS50030 UBA, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiUBS3A_HUMAN
AccessioniPrimary (citable) accession number: P57075
Secondary accession number(s): G5E9E4
, Q6HA34, Q6HA35, Q6ISI6, Q6ISK3, Q6ISS9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: December 1, 2000
Last modified: November 7, 2018
This is version 158 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again