Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Breast cancer anti-estrogen resistance protein 1

Gene

BCAR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Docking protein which plays a central coordinating role for tyrosine kinase-based signaling related to cell adhesion. Implicated in induction of cell migration. Overexpression confers antiestrogen resistance on breast cancer cells.2 Publications

GO - Molecular functioni

  • protein kinase binding Source: UniProtKB
  • SH3 domain binding Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Biological processCell adhesion

Enzyme and pathway databases

ReactomeiR-HSA-186763 Downstream signal transduction
R-HSA-372708 p130Cas linkage to MAPK signaling for integrins
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-8849471 PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases
SignaLinkiP56945
SIGNORiP56945

Names & Taxonomyi

Protein namesi
Recommended name:
Breast cancer anti-estrogen resistance protein 1
Alternative name(s):
CRK-associated substrate
Cas scaffolding protein family member 1
p130cas
Gene namesi
Name:BCAR1
Synonyms:CAS, CASS1, CRKAS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000050820.16
HGNCiHGNC:971 BCAR1
MIMi602941 gene
neXtProtiNX_P56945

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi9564
OpenTargetsiENSG00000050820
PharmGKBiPA25281

Polymorphism and mutation databases

BioMutaiBCAR1
DMDMi288558806

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000648541 – 870Breast cancer anti-estrogen resistance protein 1Add BLAST870

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionine1 Publication1
Modified residuei128Phosphotyrosine; by SRC1 Publication1
Modified residuei134PhosphoserineCombined sources1
Modified residuei139PhosphoserineCombined sources1 Publication1
Modified residuei234PhosphotyrosineBy similarity1
Modified residuei249Phosphotyrosine; by ABL1By similarity1
Modified residuei269PhosphothreonineCombined sources1
Modified residuei292PhosphoserineCombined sources1
Modified residuei362PhosphotyrosineBy similarity1
Modified residuei372PhosphotyrosineBy similarity1
Modified residuei410PhosphotyrosineBy similarity1
Modified residuei428PhosphoserineCombined sources1
Modified residuei437Phosphoserine1 Publication1
Modified residuei639PhosphoserineCombined sources1 Publication1

Post-translational modificationi

PTK2/FAK1 activation mediates phosphorylation at the YDYVHL motif; phosphorylation is most likely catalyzed by SRC family members. SRC-family kinases are recruited to the phosphorylated sites and can phosphorylate other tyrosine residues. Tyrosine phosphorylation is triggered by integrin-mediated adhesion of cells to the extracellular matrix.4 Publications
Dephosphorylated by PTPN14 at Tyr-128.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP56945
MaxQBiP56945
PaxDbiP56945
PeptideAtlasiP56945
PRIDEiP56945
ProteomicsDBi56960
56961 [P56945-2]

PTM databases

iPTMnetiP56945
PhosphoSitePlusiP56945

Expressioni

Tissue specificityi

Widely expressed with an abundant expression in the testis. Low level of expression seen in the liver, thymus, and peripheral blood leukocytes. The protein has been detected in a B-cell line.

Gene expression databases

BgeeiENSG00000050820 Expressed in 181 organ(s), highest expression level in cerebellum
CleanExiHS_BCAR1
ExpressionAtlasiP56945 baseline and differential
GenevisibleiP56945 HS

Organism-specific databases

HPAiCAB000443
HPA042282

Interactioni

Subunit structurei

Forms complexes in vivo with PTK2/FAK1, adapter protein CRKL and LYN kinase. Can heterodimerize with NEDD9. Interacts with BCAR3, the interaction regulates adhesion-dependent serine phosphorylation. Interacts with NPHP1 and SH2D3C. Interacts with activated CSPG4. Interacts with BMX, INPPL1/SHIP2 and PEAK1. Part of a collagen-stimulated complex involved in cell migration made of CDC42, CRK, TNK2 and BCAR1/p130cas. Interacts with TNK2 via SH3 domains. Interacts with PTK2B/PYK2.8 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi114934, 73 interactors
CORUMiP56945
DIPiDIP-33855N
ELMiP56945
IntActiP56945, 261 interactors
MINTiP56945
STRINGi9606.ENSP00000391669

Structurei

Secondary structure

1870
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP56945
SMRiP56945
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP56945

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini3 – 65SH3PROSITE-ProRule annotationAdd BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni115 – 416Substrate for kinasesBy similarityAdd BLAST302
Regioni746 – 796Divergent helix-loop-helix motifAdd BLAST51

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi635 – 643SH3-bindingSequence analysis9

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi74 – 87Pro-richAdd BLAST14
Compositional biasi422 – 614Ser-richAdd BLAST193

Domaini

Contains a central domain (substrate domain) containing multiple potential SH2-binding sites and a C-terminal domain containing a divergent helix-loop-helix (HLH) motif. The SH2-binding sites putatively bind CRK, NCK and ABL1 SH2 domains. The HLH motif is absolutely required for the induction of pseudohyphal growth in yeast and mediates heterodimerization with NEDD9 (By similarity).By similarity
A serine-rich region promotes activation of the serum response element (SRE).
The SH3 domain is necessary for the localization of the protein to focal adhesions and interacts with one proline-rich region of PTK2/FAK11.

Sequence similaritiesi

Belongs to the CAS family.Curated

Keywords - Domaini

SH3 domain, SH3-binding

Phylogenomic databases

eggNOGiENOG410IEDD Eukaryota
ENOG410ZSUM LUCA
GeneTreeiENSGT00490000043324
HOGENOMiHOG000261698
HOVERGENiHBG004354
InParanoidiP56945
KOiK05726
OMAiTVEHNQP
OrthoDBiEOG091G0RVA
PhylomeDBiP56945
TreeFamiTF328782

Family and domain databases

CDDicd12001 SH3_BCAR1, 1 hit
Gene3Di1.20.120.830, 1 hit
InterProiView protein in InterPro
IPR028848 BCAR1
IPR035745 BCAR1_SH3
IPR021901 CAS_C
IPR037362 CAS_fam
IPR014928 Serine_rich_dom
IPR038319 Serine_rich_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PANTHERiPTHR10654 PTHR10654, 1 hit
PTHR10654:SF15 PTHR10654:SF15, 1 hit
PfamiView protein in Pfam
PF12026 DUF3513, 1 hit
PF08824 Serine_rich, 1 hit
PF00018 SH3_1, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

Sequences (8+)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 17 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P56945-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNHLNVLAKA LYDNVAESPD ELSFRKGDIM TVLEQDTQGL DGWWLCSLHG
60 70 80 90 100
RQGIVPGNRL KILVGMYDKK PAGPGPGPPA TPAQPQPGLH APAPPASQYT
110 120 130 140 150
PMLPNTYQPQ PDSVYLVPTP SKAQQGLYQV PGPSPQFQSP PAKQTSTFSK
160 170 180 190 200
QTPHHPFPSP ATDLYQVPPG PGGPAQDIYQ VPPSAGMGHD IYQVPPSMDT
210 220 230 240 250
RSWEGTKPPA KVVVPTRVGQ GYVYEAAQPE QDEYDIPRHL LAPGPQDIYD
260 270 280 290 300
VPPVRGLLPS QYGQEVYDTP PMAVKGPNGR DPLLEVYDVP PSVEKGLPPS
310 320 330 340 350
NHHAVYDVPP SVSKDVPDGP LLREETYDVP PAFAKAKPFD PARTPLVLAA
360 370 380 390 400
PPPDSPPAED VYDVPPPAPD LYDVPPGLRR PGPGTLYDVP RERVLPPEVA
410 420 430 440 450
DGGVVDSGVY AVPPPAEREA PAEGKRLSAS STGSTRSSQS ASSLEVAGPG
460 470 480 490 500
REPLELEVAV EALARLQQGV SATVAHLLDL AGSAGATGSW RSPSEPQEPL
510 520 530 540 550
VQDLQAAVAA VQSAVHELLE FARSAVGNAA HTSDRALHAK LSRQLQKMED
560 570 580 590 600
VHQTLVAHGQ ALDAGRGGSG ATLEDLDRLV ACSRAVPEDA KQLASFLHGN
610 620 630 640 650
ASLLFRRTKA TAPGPEGGGT LHPNPTDKTS SIQSRPLPSP PKFTSQDSPD
660 670 680 690 700
GQYENSEGGW MEDYDYVHLQ GKEEFEKTQK ELLEKGSITR QGKSQLELQQ
710 720 730 740 750
LKQFERLEQE VSRPIDHDLA NWTPAQPLAP GRTGGLGPSD RQLLLFYLEQ
760 770 780 790 800
CEANLTTLTN AVDAFFTAVA TNQPPKIFVA HSKFVILSAH KLVFIGDTLS
810 820 830 840 850
RQAKAADVRS QVTHYSNLLC DLLRGIVATT KAAALQYPSP SAAQDMVERV
860 870
KELGHSTQQF RRVLGQLAAA
Length:870
Mass (Da):93,372
Last modified:February 9, 2010 - v2
Checksum:iB81EC3430049E795
GO
Isoform 2 (identifier: P56945-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MLTHRPQEAEQRGRTPGPSFEW

Note: No experimental confirmation available.
Show »
Length:888
Mass (Da):95,469
Checksum:i4CA6EC5C8EFE3DA6
GO
Isoform 3 (identifier: P56945-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-304: A → AVSKCQGNARARLRLWGVW

Show »
Length:888
Mass (Da):95,454
Checksum:iFF81642D11EB93AC
GO
Isoform 4 (identifier: P56945-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MQGK
     64-211: Missing.

Note: No experimental confirmation available.
Show »
Length:722
Mass (Da):77,731
Checksum:i2537ED6C3BEBE512
GO
Isoform 5 (identifier: P56945-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → ME

Note: No experimental confirmation available.
Show »
Length:868
Mass (Da):93,137
Checksum:iDB6B70B2AB1926CD
GO
Isoform 6 (identifier: P56945-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MPAKPFLSSVLLSWKVLDFSGPGPQGTGQPCSCGHWAEGQGGPPEPAGGP

Note: No experimental confirmation available.
Show »
Length:916
Mass (Da):97,877
Checksum:i3A5FDEB4BA15527B
GO
Isoform 7 (identifier: P56945-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MHCPGEAPLAAPRPTPKDPCLR

Note: No experimental confirmation available.
Show »
Length:888
Mass (Da):95,216
Checksum:iCD3BA8494536FC76
GO
Isoform 8 (identifier: P56945-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MSVP

Note: No experimental confirmation available.
Show »
Length:870
Mass (Da):93,291
Checksum:i2262F3718326A675
GO

Computationally mapped potential isoform sequencesi

There are 17 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2R8Y596A0A2R8Y596_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
916Annotation score:
F5H855F5H855_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
57Annotation score:
H3BVF0H3BVF0_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
120Annotation score:
H3BQJ7H3BQJ7_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
133Annotation score:
H3BTL5H3BTL5_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
50Annotation score:
H3BSB2H3BSB2_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
135Annotation score:
H3BSY4H3BSY4_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
128Annotation score:
H3BU42H3BU42_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
80Annotation score:
H3BTB0H3BTB0_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
58Annotation score:
H3BN62H3BN62_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
238Annotation score:
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti63L → S in BAB55230 (PubMed:14702039).Curated1
Sequence conflicti236I → T in AAF27527 (Ref. 2) Curated1
Sequence conflicti254V → I in BAG54099 (PubMed:14702039).Curated1
Sequence conflicti349A → G in AAF27527 (Ref. 2) Curated1
Sequence conflicti363D → Y in AAF27527 (Ref. 2) Curated1
Sequence conflicti385T → A in AAS48631 (Ref. 4) Curated1
Sequence conflicti428S → P in BAB55230 (PubMed:14702039).Curated1
Sequence conflicti471S → G in BAB55230 (PubMed:14702039).Curated1
Sequence conflicti600N → S in AAS48631 (Ref. 4) Curated1
Sequence conflicti700Q → R in BAH13763 (PubMed:14702039).Curated1
Sequence conflicti714P → L in BAG54099 (PubMed:14702039).Curated1
Sequence conflicti740D → G in AAS48631 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05897076P → S4 PublicationsCorresponds to variant dbSNP:rs1035539Ensembl.1
Natural variantiVAR_035798407S → T in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_057820491R → L. Corresponds to variant dbSNP:rs16957558Ensembl.1
Natural variantiVAR_057821558H → R. Corresponds to variant dbSNP:rs16957552Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0435591 – 4MNHL → MLTHRPQEAEQRGRTPGPSF EW in isoform 2. 1 Publication4
Alternative sequenceiVSP_0461271 – 4MNHL → MQGK in isoform 4. 1 Publication4
Alternative sequenceiVSP_0467481 – 4MNHL → ME in isoform 5. 1 Publication4
Alternative sequenceiVSP_0467491 – 4MNHL → MPAKPFLSSVLLSWKVLDFS GPGPQGTGQPCSCGHWAEGQ GGPPEPAGGP in isoform 6. 1 Publication4
Alternative sequenceiVSP_0467501 – 4MNHL → MHCPGEAPLAAPRPTPKDPC LR in isoform 7. 1 Publication4
Alternative sequenceiVSP_0467511 – 4MNHL → MSVP in isoform 8. 1 Publication4
Alternative sequenceiVSP_04612864 – 211Missing in isoform 4. 1 PublicationAdd BLAST148
Alternative sequenceiVSP_045355304A → AVSKCQGNARARLRLWGVW in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ242987 mRNA Translation: CAB75875.2
AF218451 mRNA Translation: AAF27527.1
AB040024 mRNA Translation: BAA92711.1
AY545071 mRNA Translation: AAS48631.1
AK027608 mRNA Translation: BAB55230.1
AK124815 mRNA Translation: BAG54099.1
AK293808 mRNA Translation: BAG57215.1
AK294513 mRNA Translation: BAG57726.1
AK295809 mRNA Translation: BAG58627.1
AK302617 mRNA Translation: BAH13763.1
AC009078 Genomic DNA No translation available.
CCDSiCCDS10915.1 [P56945-1]
CCDS54037.1 [P56945-5]
CCDS54038.1 [P56945-3]
CCDS54039.1 [P56945-4]
CCDS54040.1 [P56945-6]
CCDS54041.1 [P56945-8]
CCDS54042.1 [P56945-2]
CCDS54043.1 [P56945-7]
RefSeqiNP_001164185.1, NM_001170714.1 [P56945-6]
NP_001164186.1, NM_001170715.1 [P56945-7]
NP_001164187.1, NM_001170716.1 [P56945-2]
NP_001164188.1, NM_001170717.1 [P56945-3]
NP_001164189.1, NM_001170718.1 [P56945-8]
NP_001164190.1, NM_001170719.1 [P56945-5]
NP_001164191.1, NM_001170720.1 [P56945-4]
NP_055382.2, NM_014567.3 [P56945-1]
XP_016879386.1, XM_017023897.1 [P56945-6]
UniGeneiHs.479747

Genome annotation databases

EnsembliENST00000162330; ENSP00000162330; ENSG00000050820 [P56945-1]
ENST00000393420; ENSP00000377072; ENSG00000050820 [P56945-3]
ENST00000393422; ENSP00000377074; ENSG00000050820 [P56945-7]
ENST00000418647; ENSP00000391669; ENSG00000050820 [P56945-6]
ENST00000420641; ENSP00000392708; ENSG00000050820 [P56945-2]
ENST00000535626; ENSP00000440370; ENSG00000050820 [P56945-4]
ENST00000538440; ENSP00000443841; ENSG00000050820 [P56945-8]
ENST00000542031; ENSP00000440415; ENSG00000050820 [P56945-5]
GeneIDi9564
KEGGihsa:9564
UCSCiuc002fdv.4 human [P56945-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ242987 mRNA Translation: CAB75875.2
AF218451 mRNA Translation: AAF27527.1
AB040024 mRNA Translation: BAA92711.1
AY545071 mRNA Translation: AAS48631.1
AK027608 mRNA Translation: BAB55230.1
AK124815 mRNA Translation: BAG54099.1
AK293808 mRNA Translation: BAG57215.1
AK294513 mRNA Translation: BAG57726.1
AK295809 mRNA Translation: BAG58627.1
AK302617 mRNA Translation: BAH13763.1
AC009078 Genomic DNA No translation available.
CCDSiCCDS10915.1 [P56945-1]
CCDS54037.1 [P56945-5]
CCDS54038.1 [P56945-3]
CCDS54039.1 [P56945-4]
CCDS54040.1 [P56945-6]
CCDS54041.1 [P56945-8]
CCDS54042.1 [P56945-2]
CCDS54043.1 [P56945-7]
RefSeqiNP_001164185.1, NM_001170714.1 [P56945-6]
NP_001164186.1, NM_001170715.1 [P56945-7]
NP_001164187.1, NM_001170716.1 [P56945-2]
NP_001164188.1, NM_001170717.1 [P56945-3]
NP_001164189.1, NM_001170718.1 [P56945-8]
NP_001164190.1, NM_001170719.1 [P56945-5]
NP_001164191.1, NM_001170720.1 [P56945-4]
NP_055382.2, NM_014567.3 [P56945-1]
XP_016879386.1, XM_017023897.1 [P56945-6]
UniGeneiHs.479747

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WYXX-ray1.14A/B3-71[»]
3T6GX-ray2.50B/D645-870[»]
5O2MNMR-A4-73[»]
5O2PNMR-A4-73[»]
5O2QNMR-A4-73[»]
ProteinModelPortaliP56945
SMRiP56945
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114934, 73 interactors
CORUMiP56945
DIPiDIP-33855N
ELMiP56945
IntActiP56945, 261 interactors
MINTiP56945
STRINGi9606.ENSP00000391669

PTM databases

iPTMnetiP56945
PhosphoSitePlusiP56945

Polymorphism and mutation databases

BioMutaiBCAR1
DMDMi288558806

Proteomic databases

EPDiP56945
MaxQBiP56945
PaxDbiP56945
PeptideAtlasiP56945
PRIDEiP56945
ProteomicsDBi56960
56961 [P56945-2]

Protocols and materials databases

DNASUi9564
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000162330; ENSP00000162330; ENSG00000050820 [P56945-1]
ENST00000393420; ENSP00000377072; ENSG00000050820 [P56945-3]
ENST00000393422; ENSP00000377074; ENSG00000050820 [P56945-7]
ENST00000418647; ENSP00000391669; ENSG00000050820 [P56945-6]
ENST00000420641; ENSP00000392708; ENSG00000050820 [P56945-2]
ENST00000535626; ENSP00000440370; ENSG00000050820 [P56945-4]
ENST00000538440; ENSP00000443841; ENSG00000050820 [P56945-8]
ENST00000542031; ENSP00000440415; ENSG00000050820 [P56945-5]
GeneIDi9564
KEGGihsa:9564
UCSCiuc002fdv.4 human [P56945-1]

Organism-specific databases

CTDi9564
DisGeNETi9564
EuPathDBiHostDB:ENSG00000050820.16
GeneCardsiBCAR1
H-InvDBiHIX0173293
HGNCiHGNC:971 BCAR1
HPAiCAB000443
HPA042282
MIMi602941 gene
neXtProtiNX_P56945
OpenTargetsiENSG00000050820
PharmGKBiPA25281
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEDD Eukaryota
ENOG410ZSUM LUCA
GeneTreeiENSGT00490000043324
HOGENOMiHOG000261698
HOVERGENiHBG004354
InParanoidiP56945
KOiK05726
OMAiTVEHNQP
OrthoDBiEOG091G0RVA
PhylomeDBiP56945
TreeFamiTF328782

Enzyme and pathway databases

ReactomeiR-HSA-186763 Downstream signal transduction
R-HSA-372708 p130Cas linkage to MAPK signaling for integrins
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-8849471 PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases
SignaLinkiP56945
SIGNORiP56945

Miscellaneous databases

ChiTaRSiBCAR1 human
EvolutionaryTraceiP56945
GeneWikiiBCAR1
GenomeRNAii9564
PROiPR:P56945
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000050820 Expressed in 181 organ(s), highest expression level in cerebellum
CleanExiHS_BCAR1
ExpressionAtlasiP56945 baseline and differential
GenevisibleiP56945 HS

Family and domain databases

CDDicd12001 SH3_BCAR1, 1 hit
Gene3Di1.20.120.830, 1 hit
InterProiView protein in InterPro
IPR028848 BCAR1
IPR035745 BCAR1_SH3
IPR021901 CAS_C
IPR037362 CAS_fam
IPR014928 Serine_rich_dom
IPR038319 Serine_rich_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PANTHERiPTHR10654 PTHR10654, 1 hit
PTHR10654:SF15 PTHR10654:SF15, 1 hit
PfamiView protein in Pfam
PF12026 DUF3513, 1 hit
PF08824 Serine_rich, 1 hit
PF00018 SH3_1, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiBCAR1_HUMAN
AccessioniPrimary (citable) accession number: P56945
Secondary accession number(s): B3KWD7
, B4DEV4, B4DGB5, B4DIW5, B7Z7X7, E9PCL5, E9PCV2, F5GXA2, F5GXV6, F5H7Z0, F8WA69, Q6QEF7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: February 9, 2010
Last modified: November 7, 2018
This is version 186 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again