Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P56945 (BCAR1_HUMAN)

Protein

Breast cancer anti-estrogen resistance protein 1

Gene

BCAR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Docking protein which plays a central coordinating role for tyrosine kinase-based signaling related to cell adhesion. Implicated in induction of cell migration. Overexpression confers antiestrogen resistance on breast cancer cells.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein kinase binding Source: UniProtKB
  • SH3 domain binding Source: UniProtKB-KW
View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-186763 Downstream signal transduction
R-HSA-372708 p130Cas linkage to MAPK signaling for integrins
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-8849471 PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P56945

SIGNOR Signaling Network Open Resource

More...SIGNORi		P56945

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Breast cancer anti-estrogen resistance protein 1
Alternative name(s):
CRK-associated substrate
Cas scaffolding protein family member 1
p130cas
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BCAR1
Synonyms:CAS, CASS1, CRKAS
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000050820.16

Human Gene Nomenclature Database

More...HGNCi		HGNC:971 BCAR1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602941 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P56945

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		9564

Open Targets

More...OpenTargetsi		ENSG00000050820

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA25281

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		BCAR1

Domain mapping of disease mutations (DMDM)

More...DMDMi		288558806

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000648541 – 870Breast cancer anti-estrogen resistance protein 1Add BLAST870

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionine1 Publication1
Modified residuei128Phosphotyrosine; by SRC1 Publication1
Modified residuei134PhosphoserineCombined sources1
Modified residuei139PhosphoserineCombined sources1 Publication1
Modified residuei234PhosphotyrosineBy similarity1
Modified residuei249Phosphotyrosine; by ABL1By similarity1
Modified residuei269PhosphothreonineCombined sources1
Modified residuei292PhosphoserineCombined sources1
Modified residuei362PhosphotyrosineBy similarity1
Modified residuei372PhosphotyrosineBy similarity1
Modified residuei410PhosphotyrosineBy similarity1
Modified residuei428PhosphoserineCombined sources1
Modified residuei437Phosphoserine1 Publication1
Modified residuei639PhosphoserineCombined sources1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

PTK2/FAK1 activation mediates phosphorylation at the YDYVHL motif; phosphorylation is most likely catalyzed by SRC family members. SRC-family kinases are recruited to the phosphorylated sites and can phosphorylate other tyrosine residues. Tyrosine phosphorylation is triggered by integrin-mediated adhesion of cells to the extracellular matrix.4 Publications
Dephosphorylated by PTPN14 at Tyr-128.

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P56945

MaxQB - The MaxQuant DataBase

More...MaxQBi		P56945

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P56945

PeptideAtlas

More...PeptideAtlasi		P56945

PRoteomics IDEntifications database

More...PRIDEi		P56945

ProteomicsDB human proteome resource

More...ProteomicsDBi		56960
56961 [P56945-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P56945

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P56945

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed with an abundant expression in the testis. Low level of expression seen in the liver, thymus, and peripheral blood leukocytes. The protein has been detected in a B-cell line.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000050820 Expressed in 181 organ(s), highest expression level in cerebellum

CleanEx database of gene expression profiles

More...CleanExi		HS_BCAR1

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P56945 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P56945 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB000443
HPA042282

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms complexes in vivo with PTK2/FAK1, adapter protein CRKL and LYN kinase. Can heterodimerize with NEDD9. Interacts with BCAR3, the interaction regulates adhesion-dependent serine phosphorylation. Interacts with NPHP1 and SH2D3C. Interacts with activated CSPG4. Interacts with BMX, INPPL1/SHIP2 and PEAK1. Part of a collagen-stimulated complex involved in cell migration made of CDC42, CRK, TNK2 and BCAR1/p130cas. Interacts with TNK2 via SH3 domains. Interacts with PTK2B/PYK2.8 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		114934, 73 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P56945

Database of interacting proteins

More...DIPi		DIP-33855N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...ELMi		P56945

Protein interaction database and analysis system

More...IntActi		P56945, 261 interactors

Molecular INTeraction database

More...MINTi		P56945

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000391669

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1870
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		P56945

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P56945

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P56945

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini3 – 65SH3PROSITE-ProRule annotationAdd BLAST63

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni115 – 416Substrate for kinasesBy similarityAdd BLAST302
Regioni746 – 796Divergent helix-loop-helix motifAdd BLAST51

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi635 – 643SH3-bindingSequence analysis9

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi74 – 87Pro-richAdd BLAST14
Compositional biasi422 – 614Ser-richAdd BLAST193

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Contains a central domain (substrate domain) containing multiple potential SH2-binding sites and a C-terminal domain containing a divergent helix-loop-helix (HLH) motif. The SH2-binding sites putatively bind CRK, NCK and ABL1 SH2 domains. The HLH motif is absolutely required for the induction of pseudohyphal growth in yeast and mediates heterodimerization with NEDD9 (By similarity).By similarity
A serine-rich region promotes activation of the serum response element (SRE).
The SH3 domain is necessary for the localization of the protein to focal adhesions and interacts with one proline-rich region of PTK2/FAK11.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CAS family.Curated

Keywords - Domaini

SH3 domain, SH3-binding

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG410IEDD Eukaryota
ENOG410ZSUM LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000154002

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000261698

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG004354

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P56945

KEGG Orthology (KO)

More...KOi		K05726

Identification of Orthologs from Complete Genome Data

More...OMAi		TVEHNQP

Database of Orthologous Groups

More...OrthoDBi		EOG091G0RVA

Database for complete collections of gene phylogenies

More...PhylomeDBi		P56945

TreeFam database of animal gene trees

More...TreeFami		TF328782

Family and domain databases

Conserved Domains Database

More...CDDi		cd12001 SH3_BCAR1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.120.830, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR028848 BCAR1
IPR035745 BCAR1_SH3
IPR021901 CAS_C
IPR037362 CAS_fam
IPR014928 Serine_rich_dom
IPR038319 Serine_rich_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain

The PANTHER Classification System

More...PANTHERi		PTHR10654 PTHR10654, 1 hit
PTHR10654:SF15 PTHR10654:SF15, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF12026 CAS_C, 1 hit
PF08824 Serine_rich, 1 hit
PF00018 SH3_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00452 SH3DOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00326 SH3, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50044 SSF50044, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50002 SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 17 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P56945-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNHLNVLAKA LYDNVAESPD ELSFRKGDIM TVLEQDTQGL DGWWLCSLHG 
        60         70         80         90        100
RQGIVPGNRL KILVGMYDKK PAGPGPGPPA TPAQPQPGLH APAPPASQYT 
       110        120        130        140        150
PMLPNTYQPQ PDSVYLVPTP SKAQQGLYQV PGPSPQFQSP PAKQTSTFSK 
       160        170        180        190        200
QTPHHPFPSP ATDLYQVPPG PGGPAQDIYQ VPPSAGMGHD IYQVPPSMDT 
       210        220        230        240        250
RSWEGTKPPA KVVVPTRVGQ GYVYEAAQPE QDEYDIPRHL LAPGPQDIYD 
       260        270        280        290        300
VPPVRGLLPS QYGQEVYDTP PMAVKGPNGR DPLLEVYDVP PSVEKGLPPS 
       310        320        330        340        350
NHHAVYDVPP SVSKDVPDGP LLREETYDVP PAFAKAKPFD PARTPLVLAA 
       360        370        380        390        400
PPPDSPPAED VYDVPPPAPD LYDVPPGLRR PGPGTLYDVP RERVLPPEVA 
       410        420        430        440        450
DGGVVDSGVY AVPPPAEREA PAEGKRLSAS STGSTRSSQS ASSLEVAGPG 
       460        470        480        490        500
REPLELEVAV EALARLQQGV SATVAHLLDL AGSAGATGSW RSPSEPQEPL 
       510        520        530        540        550
VQDLQAAVAA VQSAVHELLE FARSAVGNAA HTSDRALHAK LSRQLQKMED 
       560        570        580        590        600
VHQTLVAHGQ ALDAGRGGSG ATLEDLDRLV ACSRAVPEDA KQLASFLHGN 
       610        620        630        640        650
ASLLFRRTKA TAPGPEGGGT LHPNPTDKTS SIQSRPLPSP PKFTSQDSPD 
       660        670        680        690        700
GQYENSEGGW MEDYDYVHLQ GKEEFEKTQK ELLEKGSITR QGKSQLELQQ 
       710        720        730        740        750
LKQFERLEQE VSRPIDHDLA NWTPAQPLAP GRTGGLGPSD RQLLLFYLEQ 
       760        770        780        790        800
CEANLTTLTN AVDAFFTAVA TNQPPKIFVA HSKFVILSAH KLVFIGDTLS 
       810        820        830        840        850
RQAKAADVRS QVTHYSNLLC DLLRGIVATT KAAALQYPSP SAAQDMVERV 
       860        870
KELGHSTQQF RRVLGQLAAA
Length:870
Mass (Da):93,372
Last modified:February 9, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB81EC3430049E795
GO
Isoform 2 (identifier: P56945-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MLTHRPQEAEQRGRTPGPSFEW

Note: No experimental confirmation available.
Show »
Length:888
Mass (Da):95,469
Checksum:i4CA6EC5C8EFE3DA6
GO
Isoform 3 (identifier: P56945-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-304: A → AVSKCQGNARARLRLWGVW

Show »
Length:888
Mass (Da):95,454
Checksum:iFF81642D11EB93AC
GO
Isoform 4 (identifier: P56945-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MQGK
     64-211: Missing.

Note: No experimental confirmation available.
Show »
Length:722
Mass (Da):77,731
Checksum:i2537ED6C3BEBE512
GO
Isoform 5 (identifier: P56945-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → ME

Note: No experimental confirmation available.
Show »
Length:868
Mass (Da):93,137
Checksum:iDB6B70B2AB1926CD
GO
Isoform 6 (identifier: P56945-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MPAKPFLSSVLLSWKVLDFSGPGPQGTGQPCSCGHWAEGQGGPPEPAGGP

Note: No experimental confirmation available.
Show »
Length:916
Mass (Da):97,877
Checksum:i3A5FDEB4BA15527B
GO
Isoform 7 (identifier: P56945-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MHCPGEAPLAAPRPTPKDPCLR

Note: No experimental confirmation available.
Show »
Length:888
Mass (Da):95,216
Checksum:iCD3BA8494536FC76
GO
Isoform 8 (identifier: P56945-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MNHL → MSVP

Note: No experimental confirmation available.
Show »
Length:870
Mass (Da):93,291
Checksum:i2262F3718326A675
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 17 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A2R8Y596A0A2R8Y596_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
916Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H855F5H855_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
57Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BTL5H3BTL5_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSB2H3BSB2_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BSY4H3BSY4_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BVF0H3BVF0_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
120Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BQJ7H3BQJ7_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BU42H3BU42_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BTB0H3BTB0_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
58Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BN62H3BN62_HUMAN
Breast cancer anti-estrogen resista...
BCAR1
238Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti63L → S in BAB55230 (PubMed:14702039).Curated1
Sequence conflicti236I → T in AAF27527 (Ref. 2) Curated1
Sequence conflicti254V → I in BAG54099 (PubMed:14702039).Curated1
Sequence conflicti349A → G in AAF27527 (Ref. 2) Curated1
Sequence conflicti363D → Y in AAF27527 (Ref. 2) Curated1
Sequence conflicti385T → A in AAS48631 (Ref. 4) Curated1
Sequence conflicti428S → P in BAB55230 (PubMed:14702039).Curated1
Sequence conflicti471S → G in BAB55230 (PubMed:14702039).Curated1
Sequence conflicti600N → S in AAS48631 (Ref. 4) Curated1
Sequence conflicti700Q → R in BAH13763 (PubMed:14702039).Curated1
Sequence conflicti714P → L in BAG54099 (PubMed:14702039).Curated1
Sequence conflicti740D → G in AAS48631 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_05897076P → S4 PublicationsCorresponds to variant dbSNP:rs1035539Ensembl.1
Natural variantiVAR_035798407S → T in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_057820491R → L. Corresponds to variant dbSNP:rs16957558Ensembl.1
Natural variantiVAR_057821558H → R. Corresponds to variant dbSNP:rs16957552Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0435591 – 4MNHL → MLTHRPQEAEQRGRTPGPSF EW in isoform 2. 1 Publication4
Alternative sequenceiVSP_0461271 – 4MNHL → MQGK in isoform 4. 1 Publication4
Alternative sequenceiVSP_0467481 – 4MNHL → ME in isoform 5. 1 Publication4
Alternative sequenceiVSP_0467491 – 4MNHL → MPAKPFLSSVLLSWKVLDFS GPGPQGTGQPCSCGHWAEGQ GGPPEPAGGP in isoform 6. 1 Publication4
Alternative sequenceiVSP_0467501 – 4MNHL → MHCPGEAPLAAPRPTPKDPC LR in isoform 7. 1 Publication4
Alternative sequenceiVSP_0467511 – 4MNHL → MSVP in isoform 8. 1 Publication4
Alternative sequenceiVSP_04612864 – 211Missing in isoform 4. 1 PublicationAdd BLAST148
Alternative sequenceiVSP_045355304A → AVSKCQGNARARLRLWGVW in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ242987 mRNA Translation: CAB75875.2
AF218451 mRNA Translation: AAF27527.1
AB040024 mRNA Translation: BAA92711.1
AY545071 mRNA Translation: AAS48631.1
AK027608 mRNA Translation: BAB55230.1
AK124815 mRNA Translation: BAG54099.1
AK293808 mRNA Translation: BAG57215.1
AK294513 mRNA Translation: BAG57726.1
AK295809 mRNA Translation: BAG58627.1
AK302617 mRNA Translation: BAH13763.1
AC009078 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS10915.1 [P56945-1]
CCDS54037.1 [P56945-5]
CCDS54038.1 [P56945-3]
CCDS54039.1 [P56945-4]
CCDS54040.1 [P56945-6]
CCDS54041.1 [P56945-8]
CCDS54042.1 [P56945-2]
CCDS54043.1 [P56945-7]

NCBI Reference Sequences

More...RefSeqi		NP_001164185.1, NM_001170714.1 [P56945-6]
NP_001164186.1, NM_001170715.1 [P56945-7]
NP_001164187.1, NM_001170716.1 [P56945-2]
NP_001164188.1, NM_001170717.1 [P56945-3]
NP_001164189.1, NM_001170718.1 [P56945-8]
NP_001164190.1, NM_001170719.1 [P56945-5]
NP_001164191.1, NM_001170720.1 [P56945-4]
NP_055382.2, NM_014567.3 [P56945-1]
XP_016879386.1, XM_017023897.1 [P56945-6]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.479747

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000162330; ENSP00000162330; ENSG00000050820 [P56945-1]
ENST00000393420; ENSP00000377072; ENSG00000050820 [P56945-3]
ENST00000393422; ENSP00000377074; ENSG00000050820 [P56945-7]
ENST00000418647; ENSP00000391669; ENSG00000050820 [P56945-6]
ENST00000420641; ENSP00000392708; ENSG00000050820 [P56945-2]
ENST00000535626; ENSP00000440370; ENSG00000050820 [P56945-4]
ENST00000538440; ENSP00000443841; ENSG00000050820 [P56945-8]
ENST00000542031; ENSP00000440415; ENSG00000050820 [P56945-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		9564

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:9564

UCSC genome browser

More...UCSCi		uc002fdv.4 human [P56945-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ242987 mRNA Translation: CAB75875.2
AF218451 mRNA Translation: AAF27527.1
AB040024 mRNA Translation: BAA92711.1
AY545071 mRNA Translation: AAS48631.1
AK027608 mRNA Translation: BAB55230.1
AK124815 mRNA Translation: BAG54099.1
AK293808 mRNA Translation: BAG57215.1
AK294513 mRNA Translation: BAG57726.1
AK295809 mRNA Translation: BAG58627.1
AK302617 mRNA Translation: BAH13763.1
AC009078 Genomic DNA No translation available.
CCDSiCCDS10915.1 [P56945-1]
CCDS54037.1 [P56945-5]
CCDS54038.1 [P56945-3]
CCDS54039.1 [P56945-4]
CCDS54040.1 [P56945-6]
CCDS54041.1 [P56945-8]
CCDS54042.1 [P56945-2]
CCDS54043.1 [P56945-7]
RefSeqiNP_001164185.1, NM_001170714.1 [P56945-6]
NP_001164186.1, NM_001170715.1 [P56945-7]
NP_001164187.1, NM_001170716.1 [P56945-2]
NP_001164188.1, NM_001170717.1 [P56945-3]
NP_001164189.1, NM_001170718.1 [P56945-8]
NP_001164190.1, NM_001170719.1 [P56945-5]
NP_001164191.1, NM_001170720.1 [P56945-4]
NP_055382.2, NM_014567.3 [P56945-1]
XP_016879386.1, XM_017023897.1 [P56945-6]
UniGeneiHs.479747

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1WYXX-ray1.14A/B3-71[»]
3T6GX-ray2.50B/D645-870[»]
5O2MNMR-A4-73[»]
5O2PNMR-A4-73[»]
5O2QNMR-A4-73[»]
ProteinModelPortaliP56945
SMRiP56945
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114934, 73 interactors
CORUMiP56945
DIPiDIP-33855N
ELMiP56945
IntActiP56945, 261 interactors
MINTiP56945
STRINGi9606.ENSP00000391669

PTM databases

iPTMnetiP56945
PhosphoSitePlusiP56945

Polymorphism and mutation databases

BioMutaiBCAR1
DMDMi288558806

Proteomic databases

EPDiP56945
MaxQBiP56945
PaxDbiP56945
PeptideAtlasiP56945
PRIDEiP56945
ProteomicsDBi56960
56961 [P56945-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		9564
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000162330; ENSP00000162330; ENSG00000050820 [P56945-1]
ENST00000393420; ENSP00000377072; ENSG00000050820 [P56945-3]
ENST00000393422; ENSP00000377074; ENSG00000050820 [P56945-7]
ENST00000418647; ENSP00000391669; ENSG00000050820 [P56945-6]
ENST00000420641; ENSP00000392708; ENSG00000050820 [P56945-2]
ENST00000535626; ENSP00000440370; ENSG00000050820 [P56945-4]
ENST00000538440; ENSP00000443841; ENSG00000050820 [P56945-8]
ENST00000542031; ENSP00000440415; ENSG00000050820 [P56945-5]
GeneIDi9564
KEGGihsa:9564
UCSCiuc002fdv.4 human [P56945-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		9564
DisGeNETi9564
EuPathDBiHostDB:ENSG00000050820.16

GeneCards: human genes, protein and diseases

More...GeneCardsi		BCAR1

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0173293
HGNCiHGNC:971 BCAR1
HPAiCAB000443
HPA042282
MIMi602941 gene
neXtProtiNX_P56945
OpenTargetsiENSG00000050820
PharmGKBiPA25281

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG410IEDD Eukaryota
ENOG410ZSUM LUCA
GeneTreeiENSGT00940000154002
HOGENOMiHOG000261698
HOVERGENiHBG004354
InParanoidiP56945
KOiK05726
OMAiTVEHNQP
OrthoDBiEOG091G0RVA
PhylomeDBiP56945
TreeFamiTF328782

Enzyme and pathway databases

ReactomeiR-HSA-186763 Downstream signal transduction
R-HSA-372708 p130Cas linkage to MAPK signaling for integrins
R-HSA-4420097 VEGFA-VEGFR2 Pathway
R-HSA-8849471 PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases
SignaLinkiP56945
SIGNORiP56945

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		BCAR1 human
EvolutionaryTraceiP56945

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		BCAR1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		9564

Protein Ontology

More...PROi		PR:P56945

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000050820 Expressed in 181 organ(s), highest expression level in cerebellum
CleanExiHS_BCAR1
ExpressionAtlasiP56945 baseline and differential
GenevisibleiP56945 HS

Family and domain databases

CDDicd12001 SH3_BCAR1, 1 hit
Gene3Di1.20.120.830, 1 hit
InterProiView protein in InterPro
IPR028848 BCAR1
IPR035745 BCAR1_SH3
IPR021901 CAS_C
IPR037362 CAS_fam
IPR014928 Serine_rich_dom
IPR038319 Serine_rich_sf
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
PANTHERiPTHR10654 PTHR10654, 1 hit
PTHR10654:SF15 PTHR10654:SF15, 1 hit
PfamiView protein in Pfam
PF12026 CAS_C, 1 hit
PF08824 Serine_rich, 1 hit
PF00018 SH3_1, 1 hit
PRINTSiPR00452 SH3DOMAIN
SMARTiView protein in SMART
SM00326 SH3, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBCAR1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P56945
Secondary accession number(s): B3KWD7
, B4DEV4, B4DGB5, B4DIW5, B7Z7X7, E9PCL5, E9PCV2, F5GXA2, F5GXV6, F5H7Z0, F8WA69, Q6QEF7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 30, 2000
Last sequence update: February 9, 2010
Last modified: December 5, 2018
This is version 187 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again