Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 172 (13 Feb 2019)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

ATP synthase subunit f, mitochondrial

Gene

ATP5MF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain. Minor subunit located with subunit a in the membrane.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • transmembrane transporter activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processATP synthesis, Hydrogen ion transport, Ion transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-163210 Formation of ATP by chemiosmotic coupling
R-HSA-8949613 Cristae formation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
ATP synthase subunit f, mitochondrialCurated
Alternative name(s):
ATP synthase membrane subunit fCurated
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATP5MFImported
Synonyms:ATP5J2, ATP5JL
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000241468.7

Human Gene Nomenclature Database

More...
HGNCi
HGNC:848 ATP5MF

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P56134

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei63 – 82HelicalSequence analysisAdd BLAST20

Keywords - Cellular componenti

CF(0), Membrane, Mitochondrion, Mitochondrion inner membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
9551

Open Targets

More...
OpenTargetsi
ENSG00000241468

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25138

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ATP5J2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
7404340

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001948242 – 94ATP synthase subunit f, mitochondrialAdd BLAST93

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei3PhosphoserineBy similarity1
Modified residuei22N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P56134

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P56134

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P56134

PeptideAtlas

More...
PeptideAtlasi
P56134

PRoteomics IDEntifications database

More...
PRIDEi
P56134

ProteomicsDB human proteome resource

More...
ProteomicsDBi
56886
56887 [P56134-2]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P56134-1 [P56134-1]
P56134-2 [P56134-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P56134

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P56134

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P56134

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000241468 Expressed in 234 organ(s), highest expression level in anterior cingulate cortex

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P56134 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P56134 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA067267
HPA070412

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel. CF0 seems to have nine subunits: a, b, c, d, e, f, g, F6 and 8 (or A6L). Component of an ATP synthase complex composed of ATP5PB, ATP5MC1, ATP5F1E, ATP5H, ATP5ME, ATP5PF, ATP5MF, MT-ATP6, MT-ATP8, ATP5F1A, ATP5F1B, ATP5F1D, ATP5F1C, ATP5PO, ATP5MG, ATP5MD and MP68 (By similarity).By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
114923, 50 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P56134

Protein interaction database and analysis system

More...
IntActi
P56134, 30 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000292475

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P56134

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ATPase F chain family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4092 Eukaryota
ENOG4111PBN LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00510000046986

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000034215

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG002418

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P56134

KEGG Orthology (KO)

More...
KOi
K02130

Database of Orthologous Groups

More...
OrthoDBi
1479342at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P56134

TreeFam database of animal gene trees

More...
TreeFami
TF342865

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019344 F1F0-ATPsyn_F_prd

The PANTHER Classification System

More...
PANTHERi
PTHR13080 PTHR13080, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10206 WRW, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P56134-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASVGECPAP VPVKDKKLLE VKLGELPSWI LMRDFSPSGI FGAFQRGYYR
60 70 80 90
YYNKYINVKK GSISGITMVL ACYVLFSYSF SYKHLKHERL RKYH
Length:94
Mass (Da):10,918
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD5F0D94273DEF880
GO
Isoform 2 (identifier: P56134-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-10: Missing.

Note: No experimental confirmation available.
Show »
Length:88
Mass (Da):10,363
Checksum:i38072EB09CAC8D65
GO
Isoform 3 (identifier: P56134-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     47-86: GYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLK → E

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:55
Mass (Da):6,295
Checksum:iC19548A6E4E7BF11
GO
Isoform 4 (identifier: P56134-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-10: Missing.
     47-86: GYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLK → E

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:49
Mass (Da):5,741
Checksum:i3B1C513E7C1FA43F
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JU26C9JU26_HUMAN
ATP synthase subunit f, mitochondri...
ATP5MF
98Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RKA0E5RKA0_HUMAN
ATP synthase subunit f, mitochondri...
ATP5MF
19Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti24G → L in AAH03678 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0004375 – 10Missing in isoform 2 and isoform 4. 1 Publication6
Alternative sequenceiVSP_04674647 – 86GYYRY…YKHLK → E in isoform 3 and isoform 4. CuratedAdd BLAST40

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF088918 mRNA Translation: AAC34895.1
AF047436 mRNA Translation: AAC39887.1
AY046911 mRNA Translation: AAL06647.1
CR456891 mRNA Translation: CAG33172.1
CR542155 mRNA Translation: CAG46952.1
AC073063 Genomic DNA No translation available.
CH236956 Genomic DNA Translation: EAL23877.1
CH471091 Genomic DNA Translation: EAW76661.1
BC003678 mRNA Translation: AAH03678.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34692.1 [P56134-3]
CCDS47653.1 [P56134-4]
CCDS47654.1 [P56134-2]
CCDS5665.1 [P56134-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001003713.1, NM_001003713.2 [P56134-2]
NP_001003714.1, NM_001003714.2 [P56134-3]
NP_001034267.1, NM_001039178.2 [P56134-4]
NP_004880.1, NM_004889.3 [P56134-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.521056
Hs.656515

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000292475; ENSP00000292475; ENSG00000241468 [P56134-1]
ENST00000359832; ENSP00000352890; ENSG00000241468 [P56134-3]
ENST00000394186; ENSP00000377740; ENSG00000241468 [P56134-2]
ENST00000414062; ENSP00000412149; ENSG00000241468 [P56134-4]
ENST00000488775; ENSP00000418197; ENSG00000241468 [P56134-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
9551

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:9551

UCSC genome browser

More...
UCSCi
uc003uql.4 human [P56134-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF088918 mRNA Translation: AAC34895.1
AF047436 mRNA Translation: AAC39887.1
AY046911 mRNA Translation: AAL06647.1
CR456891 mRNA Translation: CAG33172.1
CR542155 mRNA Translation: CAG46952.1
AC073063 Genomic DNA No translation available.
CH236956 Genomic DNA Translation: EAL23877.1
CH471091 Genomic DNA Translation: EAW76661.1
BC003678 mRNA Translation: AAH03678.1
CCDSiCCDS34692.1 [P56134-3]
CCDS47653.1 [P56134-4]
CCDS47654.1 [P56134-2]
CCDS5665.1 [P56134-1]
RefSeqiNP_001003713.1, NM_001003713.2 [P56134-2]
NP_001003714.1, NM_001003714.2 [P56134-3]
NP_001034267.1, NM_001039178.2 [P56134-4]
NP_004880.1, NM_004889.3 [P56134-1]
UniGeneiHs.521056
Hs.656515

3D structure databases

ProteinModelPortaliP56134
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114923, 50 interactors
CORUMiP56134
IntActiP56134, 30 interactors
STRINGi9606.ENSP00000292475

PTM databases

iPTMnetiP56134
PhosphoSitePlusiP56134
SwissPalmiP56134

Polymorphism and mutation databases

BioMutaiATP5J2
DMDMi7404340

Proteomic databases

EPDiP56134
jPOSTiP56134
PaxDbiP56134
PeptideAtlasiP56134
PRIDEiP56134
ProteomicsDBi56886
56887 [P56134-2]
TopDownProteomicsiP56134-1 [P56134-1]
P56134-2 [P56134-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000292475; ENSP00000292475; ENSG00000241468 [P56134-1]
ENST00000359832; ENSP00000352890; ENSG00000241468 [P56134-3]
ENST00000394186; ENSP00000377740; ENSG00000241468 [P56134-2]
ENST00000414062; ENSP00000412149; ENSG00000241468 [P56134-4]
ENST00000488775; ENSP00000418197; ENSG00000241468 [P56134-4]
GeneIDi9551
KEGGihsa:9551
UCSCiuc003uql.4 human [P56134-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
9551
DisGeNETi9551
EuPathDBiHostDB:ENSG00000241468.7

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ATP5MF
HGNCiHGNC:848 ATP5MF
HPAiHPA067267
HPA070412
neXtProtiNX_P56134
OpenTargetsiENSG00000241468
PharmGKBiPA25138

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4092 Eukaryota
ENOG4111PBN LUCA
GeneTreeiENSGT00510000046986
HOGENOMiHOG000034215
HOVERGENiHBG002418
InParanoidiP56134
KOiK02130
OrthoDBi1479342at2759
PhylomeDBiP56134
TreeFamiTF342865

Enzyme and pathway databases

ReactomeiR-HSA-163210 Formation of ATP by chemiosmotic coupling
R-HSA-8949613 Cristae formation

Miscellaneous databases

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ATP5J2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
9551

Protein Ontology

More...
PROi
PR:P56134

Gene expression databases

BgeeiENSG00000241468 Expressed in 234 organ(s), highest expression level in anterior cingulate cortex
ExpressionAtlasiP56134 baseline and differential
GenevisibleiP56134 HS

Family and domain databases

InterProiView protein in InterPro
IPR019344 F1F0-ATPsyn_F_prd
PANTHERiPTHR13080 PTHR13080, 1 hit
PfamiView protein in Pfam
PF10206 WRW, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATPK_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P56134
Secondary accession number(s): C9J8H9
, F8W7V3, O76079, Q6IBB3, Q96L83, Q9BTI8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 23, 2007
Last modified: February 13, 2019
This is version 172 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again