Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ATP synthase subunit f, mitochondrial

Gene

ATP5MF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F1 - containing the extramembraneous catalytic core and F0 - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F1 is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F0 domain. Minor subunit located with subunit a in the membrane.

GO - Molecular functioni

  • transmembrane transporter activity Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processATP synthesis, Hydrogen ion transport, Ion transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-163210 Formation of ATP by chemiosmotic coupling
R-HSA-8949613 Cristae formation

Names & Taxonomyi

Protein namesi
Recommended name:
ATP synthase subunit f, mitochondrialCurated
Alternative name(s):
ATP synthase membrane subunit fCurated
Gene namesi
Name:ATP5MFImported
Synonyms:ATP5J2, ATP5JL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000241468.7
HGNCiHGNC:848 ATP5MF
neXtProtiNX_P56134

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei63 – 82HelicalSequence analysisAdd BLAST20

Keywords - Cellular componenti

CF(0), Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi9551
OpenTargetsiENSG00000241468
PharmGKBiPA25138

Polymorphism and mutation databases

BioMutaiATP5J2
DMDMi7404340

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00001948242 – 94ATP synthase subunit f, mitochondrialAdd BLAST93

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei3PhosphoserineBy similarity1
Modified residuei22N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiP56134
PaxDbiP56134
PeptideAtlasiP56134
PRIDEiP56134
ProteomicsDBi56886
56887 [P56134-2]
TopDownProteomicsiP56134-1 [P56134-1]
P56134-2 [P56134-2]

PTM databases

iPTMnetiP56134
PhosphoSitePlusiP56134
SwissPalmiP56134

Expressioni

Gene expression databases

BgeeiENSG00000241468 Expressed in 234 organ(s), highest expression level in anterior cingulate cortex
CleanExiHS_ATP5J2
ExpressionAtlasiP56134 baseline and differential
GenevisibleiP56134 HS

Organism-specific databases

HPAiHPA067267
HPA070412

Interactioni

Subunit structurei

F-type ATPases have 2 components, CF1 - the catalytic core - and CF0 - the membrane proton channel. CF0 seems to have nine subunits: a, b, c, d, e, f, g, F6 and 8 (or A6L). Component of an ATP synthase complex composed of ATP5PB, ATP5MC1, ATP5F1E, ATP5H, ATP5ME, ATP5PF, ATP5MF, MT-ATP6, MT-ATP8, ATP5F1A, ATP5F1B, ATP5F1D, ATP5F1C, ATP5PO, ATP5MG, ATP5MD and MP68 (By similarity).By similarity

Protein-protein interaction databases

BioGridi114923, 48 interactors
CORUMiP56134
IntActiP56134, 31 interactors
STRINGi9606.ENSP00000292475

Structurei

3D structure databases

ProteinModelPortaliP56134
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ATPase F chain family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4092 Eukaryota
ENOG4111PBN LUCA
GeneTreeiENSGT00510000046986
HOGENOMiHOG000034215
HOVERGENiHBG002418
InParanoidiP56134
KOiK02130
PhylomeDBiP56134
TreeFamiTF342865

Family and domain databases

InterProiView protein in InterPro
IPR019344 F1F0-ATPsyn_F_prd
PANTHERiPTHR13080 PTHR13080, 1 hit
PfamiView protein in Pfam
PF10206 WRW, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P56134-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASVGECPAP VPVKDKKLLE VKLGELPSWI LMRDFSPSGI FGAFQRGYYR
60 70 80 90
YYNKYINVKK GSISGITMVL ACYVLFSYSF SYKHLKHERL RKYH
Length:94
Mass (Da):10,918
Last modified:January 23, 2007 - v3
Checksum:iD5F0D94273DEF880
GO
Isoform 2 (identifier: P56134-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-10: Missing.

Note: No experimental confirmation available.
Show »
Length:88
Mass (Da):10,363
Checksum:i38072EB09CAC8D65
GO
Isoform 3 (identifier: P56134-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     47-86: GYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLK → E

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:55
Mass (Da):6,295
Checksum:iC19548A6E4E7BF11
GO
Isoform 4 (identifier: P56134-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-10: Missing.
     47-86: GYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLK → E

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:49
Mass (Da):5,741
Checksum:i3B1C513E7C1FA43F
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JU26C9JU26_HUMAN
ATP synthase subunit f, mitochondri...
ATP5MF
98Annotation score:
E5RKA0E5RKA0_HUMAN
ATP synthase subunit f, mitochondri...
ATP5MF
19Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti24G → L in AAH03678 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0004375 – 10Missing in isoform 2 and isoform 4. 1 Publication6
Alternative sequenceiVSP_04674647 – 86GYYRY…YKHLK → E in isoform 3 and isoform 4. CuratedAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF088918 mRNA Translation: AAC34895.1
AF047436 mRNA Translation: AAC39887.1
AY046911 mRNA Translation: AAL06647.1
CR456891 mRNA Translation: CAG33172.1
CR542155 mRNA Translation: CAG46952.1
AC073063 Genomic DNA No translation available.
CH236956 Genomic DNA Translation: EAL23877.1
CH471091 Genomic DNA Translation: EAW76661.1
BC003678 mRNA Translation: AAH03678.1
CCDSiCCDS34692.1 [P56134-3]
CCDS47653.1 [P56134-4]
CCDS47654.1 [P56134-2]
CCDS5665.1 [P56134-1]
RefSeqiNP_001003713.1, NM_001003713.2 [P56134-2]
NP_001003714.1, NM_001003714.2 [P56134-3]
NP_001034267.1, NM_001039178.2 [P56134-4]
NP_004880.1, NM_004889.3 [P56134-1]
UniGeneiHs.521056
Hs.656515

Genome annotation databases

EnsembliENST00000292475; ENSP00000292475; ENSG00000241468 [P56134-1]
ENST00000359832; ENSP00000352890; ENSG00000241468 [P56134-3]
ENST00000394186; ENSP00000377740; ENSG00000241468 [P56134-2]
ENST00000414062; ENSP00000412149; ENSG00000241468 [P56134-4]
ENST00000488775; ENSP00000418197; ENSG00000241468 [P56134-4]
GeneIDi9551
KEGGihsa:9551
UCSCiuc003uql.4 human [P56134-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF088918 mRNA Translation: AAC34895.1
AF047436 mRNA Translation: AAC39887.1
AY046911 mRNA Translation: AAL06647.1
CR456891 mRNA Translation: CAG33172.1
CR542155 mRNA Translation: CAG46952.1
AC073063 Genomic DNA No translation available.
CH236956 Genomic DNA Translation: EAL23877.1
CH471091 Genomic DNA Translation: EAW76661.1
BC003678 mRNA Translation: AAH03678.1
CCDSiCCDS34692.1 [P56134-3]
CCDS47653.1 [P56134-4]
CCDS47654.1 [P56134-2]
CCDS5665.1 [P56134-1]
RefSeqiNP_001003713.1, NM_001003713.2 [P56134-2]
NP_001003714.1, NM_001003714.2 [P56134-3]
NP_001034267.1, NM_001039178.2 [P56134-4]
NP_004880.1, NM_004889.3 [P56134-1]
UniGeneiHs.521056
Hs.656515

3D structure databases

ProteinModelPortaliP56134
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114923, 48 interactors
CORUMiP56134
IntActiP56134, 31 interactors
STRINGi9606.ENSP00000292475

PTM databases

iPTMnetiP56134
PhosphoSitePlusiP56134
SwissPalmiP56134

Polymorphism and mutation databases

BioMutaiATP5J2
DMDMi7404340

Proteomic databases

EPDiP56134
PaxDbiP56134
PeptideAtlasiP56134
PRIDEiP56134
ProteomicsDBi56886
56887 [P56134-2]
TopDownProteomicsiP56134-1 [P56134-1]
P56134-2 [P56134-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000292475; ENSP00000292475; ENSG00000241468 [P56134-1]
ENST00000359832; ENSP00000352890; ENSG00000241468 [P56134-3]
ENST00000394186; ENSP00000377740; ENSG00000241468 [P56134-2]
ENST00000414062; ENSP00000412149; ENSG00000241468 [P56134-4]
ENST00000488775; ENSP00000418197; ENSG00000241468 [P56134-4]
GeneIDi9551
KEGGihsa:9551
UCSCiuc003uql.4 human [P56134-1]

Organism-specific databases

CTDi9551
DisGeNETi9551
EuPathDBiHostDB:ENSG00000241468.7
GeneCardsiATP5MF
HGNCiHGNC:848 ATP5MF
HPAiHPA067267
HPA070412
neXtProtiNX_P56134
OpenTargetsiENSG00000241468
PharmGKBiPA25138
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4092 Eukaryota
ENOG4111PBN LUCA
GeneTreeiENSGT00510000046986
HOGENOMiHOG000034215
HOVERGENiHBG002418
InParanoidiP56134
KOiK02130
PhylomeDBiP56134
TreeFamiTF342865

Enzyme and pathway databases

ReactomeiR-HSA-163210 Formation of ATP by chemiosmotic coupling
R-HSA-8949613 Cristae formation

Miscellaneous databases

GeneWikiiATP5J2
GenomeRNAii9551
PROiPR:P56134

Gene expression databases

BgeeiENSG00000241468 Expressed in 234 organ(s), highest expression level in anterior cingulate cortex
CleanExiHS_ATP5J2
ExpressionAtlasiP56134 baseline and differential
GenevisibleiP56134 HS

Family and domain databases

InterProiView protein in InterPro
IPR019344 F1F0-ATPsyn_F_prd
PANTHERiPTHR13080 PTHR13080, 1 hit
PfamiView protein in Pfam
PF10206 WRW, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiATPK_HUMAN
AccessioniPrimary (citable) accession number: P56134
Secondary accession number(s): C9J8H9
, F8W7V3, O76079, Q6IBB3, Q96L83, Q9BTI8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 23, 2007
Last modified: November 7, 2018
This is version 169 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again