Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 196 (18 Sep 2019)
Sequence version 1 (01 Nov 1997)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

BH3-interacting domain death agonist

Gene

BID

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The major proteolytic product p15 BID allows the release of cytochrome c (By similarity). Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2.By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-111447 Activation of BAD and translocation to mitochondria
R-HSA-111452 Activation and oligomerization of BAK protein
R-HSA-111453 BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
R-HSA-114294 Activation, translocation and oligomerization of BAX
R-HSA-6803204 TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
R-HSA-75108 Activation, myristolyation of BID and translocation to mitochondria

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P55957

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
BH3-interacting domain death agonist
Alternative name(s):
p22 BID
Short name:
BID
Cleaved into the following 3 chains:
Alternative name(s):
p15 BID
Alternative name(s):
p13 BID
Alternative name(s):
p11 BID
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BID
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1050 BID

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601997 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P55957

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion, Mitochondrion outer membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
637

Open Targets

More...
OpenTargetsi
ENSG00000015475

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA25353

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
BID

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2493285

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001431011 – 195BH3-interacting domain death agonistAdd BLAST195
ChainiPRO_000022323362 – 195BH3-interacting domain death agonist p15By similarityAdd BLAST134
ChainiPRO_000022323277 – 195BH3-interacting domain death agonist p13By similarityAdd BLAST119
ChainiPRO_0000223231100 – 195BH3-interacting domain death agonist p11By similarityAdd BLAST96

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei54PhosphotyrosineCombined sources1
Modified residuei78PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

TNF-alpha induces a caspase-mediated cleavage of p22 BID into a major p15 and minor p13 and p11 products.By similarity
p15 BID is ubiquitinated by ITCH; ubiquitination results in proteasome-dependent degradation.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei61 – 62CleavageBy similarity2
Sitei76 – 77CleavageBy similarity2
Sitei99 – 100CleavageBy similarity2

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P55957

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P55957

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P55957

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P55957

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P55957

PeptideAtlas

More...
PeptideAtlasi
P55957

PRoteomics IDEntifications database

More...
PRIDEi
P55957

ProteomicsDB human proteome resource

More...
ProteomicsDBi
12613 [P55957-4]
56882 [P55957-1]
56883 [P55957-2]
56884 [P55957-3]
56885 [P55957-4]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P55957-1 [P55957-1]
P55957-4 [P55957-4]

2D gel databases

USC-OGP 2-DE database

More...
OGPi
P55957

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P55957

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P55957

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P55957

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 2 and isoform 3 are expressed in spleen, bone marrow, cerebral and cerebellar cortex. Isoform 2 is expressed in spleen, pancreas and placenta (at protein level). Isoform 3 is expressed in lung, pancreas and spleen (at protein level). Isoform 4 is expressed in lung and pancreas (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000015475 Expressed in 194 organ(s), highest expression level in blood

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P55957 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P55957 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB003771
HPA000722

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms heterodimers either with the pro-apoptotic protein BAX or the anti-apoptotic protein Bcl-2 (By similarity). p15 BID interacts with ITCH (PubMed:20392206).

Interacts with PLEKHN1 (PubMed:29531808).

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107106, 55 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...
ComplexPortali
CPX-1984 BID:BCL-2 complex
CPX-1991 BID:BCL-XL complex

Database of interacting proteins

More...
DIPi
DIP-34937N

Protein interaction database and analysis system

More...
IntActi
P55957, 39 interactors

Molecular INTeraction database

More...
MINTi
P55957

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000318822

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1195
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P55957

Database of comparative protein structure models

More...
ModBasei
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P55957

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi86 – 100BH3By similarityAdd BLAST15

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IVZ7 Eukaryota
ENOG410ZF8F LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000002868

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000010016

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P55957

KEGG Orthology (KO)

More...
KOi
K04726

Identification of Orthologs from Complete Genome Data

More...
OMAi
FRTTVNF

Database of Orthologous Groups

More...
OrthoDBi
1218538at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P55957

TreeFam database of animal gene trees

More...
TreeFami
TF102047

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.437.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR020728 Bcl2_BH3_motif_CS
IPR010479 BID
IPR036834 Blc2-like_sf

The PANTHER Classification System

More...
PANTHERi
PTHR35447 PTHR35447, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF06393 BID, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF038018 BID, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF56854 SSF56854, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01259 BH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P55957-1) [UniParc]FASTAAdd to basket
Also known as: BID(L)

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDCEVNNGSS LRDECITNLL VFGFLQSCSD NSFRRELDAL GHELPVLAPQ
60 70 80 90 100
WEGYDELQTD GNRSSHSRLG RIEADSESQE DIIRNIARHL AQVGDSMDRS
110 120 130 140 150
IPPGLVNGLA LQLRNTSRSE EDRNRDLATA LEQLLQAYPR DMEKEKTMLV
160 170 180 190
LALLLAKKVA SHTPSLLRDV FHTTVNFINQ NLRTYVRSLA RNGMD
Length:195
Mass (Da):21,995
Last modified:November 1, 1997 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB17A07334C1AFBEF
GO
Isoform 2 (identifier: P55957-2) [UniParc]FASTAAdd to basket
Also known as: BID(EL)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCSGAGVMMARWAARGRAGWRSTVRILSPLGHCEPGVSRSCRAAQAM

Show »
Length:241
Mass (Da):26,836
Checksum:i437706F65542B380
GO
Isoform 3 (identifier: P55957-3) [UniParc]FASTAAdd to basket
Also known as: BID(S)

The sequence of this isoform differs from the canonical sequence as follows:
     75-137: DSESQEDIIR...ATALEQLLQA → GASDNNTASA...AWTVASLRAW
     138-195: Missing.

Show »
Length:137
Mass (Da):14,620
Checksum:i00B4D060E01FA1B8
GO
Isoform 4 (identifier: P55957-4) [UniParc]FASTAAdd to basket
Also known as: BID(ES)

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.

Show »
Length:99
Mass (Da):11,263
Checksum:i482F50C9C7DF86B0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B2ZP78B2ZP78_HUMAN
BH3-interacting domain death agonis...
BID
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH22072 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01884510S → G1 PublicationCorresponds to variant dbSNP:rs8190315Ensembl.1
Natural variantiVAR_025332162H → Q1 PublicationCorresponds to variant dbSNP:rs17853595Ensembl.1
Natural variantiVAR_061041194M → T. Corresponds to variant dbSNP:rs59225839Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0172661 – 96Missing in isoform 4. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_0172671M → MCSGAGVMMARWAARGRAGW RSTVRILSPLGHCEPGVSRS CRAAQAM in isoform 2. 2 Publications1
Alternative sequenceiVSP_01726875 – 137DSESQ…QLLQA → GASDNNTASAEEETEAAGSV AVERGLHGAATVILKVKKTS SGILPGTSPRSGTAWTVASL RAW in isoform 3. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_017269138 – 195Missing in isoform 3. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF042083 mRNA Translation: AAC34365.1
AF250233 mRNA Translation: AAO32633.1
AY005151 mRNA Translation: AAF89091.1
AF087891 mRNA Translation: AAP97190.1
CR456389 mRNA Translation: CAG30275.1
CR407603 mRNA Translation: CAG28531.1
AY309922 Genomic DNA Translation: AAP50259.1
BC009197 mRNA Translation: AAH09197.1
BC022072 mRNA Translation: AAH22072.2 Different initiation.
BC033634 mRNA Translation: AAH33634.1
BC036364 mRNA Translation: AAH36364.2

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13747.1 [P55957-2]
CCDS13748.1 [P55957-1]
CCDS13749.1 [P55957-4]

NCBI Reference Sequences

More...
RefSeqi
NP_001187.1, NM_001196.3 [P55957-1]
NP_001231496.1, NM_001244567.1 [P55957-1]
NP_001231498.1, NM_001244569.1 [P55957-4]
NP_001231499.1, NM_001244570.1 [P55957-4]
NP_001231501.1, NM_001244572.1 [P55957-4]
NP_932070.1, NM_197966.2 [P55957-2]
NP_932071.1, NM_197967.2 [P55957-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000317361; ENSP00000318822; ENSG00000015475 [P55957-2]
ENST00000342111; ENSP00000344594; ENSG00000015475 [P55957-3]
ENST00000399765; ENSP00000382667; ENSG00000015475 [P55957-4]
ENST00000399767; ENSP00000382669; ENSG00000015475 [P55957-4]
ENST00000399774; ENSP00000382674; ENSG00000015475 [P55957-1]
ENST00000551952; ENSP00000449236; ENSG00000015475 [P55957-1]
ENST00000611040; ENSP00000483709; ENSG00000015475 [P55957-4]
ENST00000614949; ENSP00000477773; ENSG00000015475 [P55957-4]
ENST00000615414; ENSP00000483534; ENSG00000015475 [P55957-4]
ENST00000622694; ENSP00000480414; ENSG00000015475 [P55957-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
637

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:637

UCSC genome browser

More...
UCSCi
uc002znc.3 human [P55957-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF042083 mRNA Translation: AAC34365.1
AF250233 mRNA Translation: AAO32633.1
AY005151 mRNA Translation: AAF89091.1
AF087891 mRNA Translation: AAP97190.1
CR456389 mRNA Translation: CAG30275.1
CR407603 mRNA Translation: CAG28531.1
AY309922 Genomic DNA Translation: AAP50259.1
BC009197 mRNA Translation: AAH09197.1
BC022072 mRNA Translation: AAH22072.2 Different initiation.
BC033634 mRNA Translation: AAH33634.1
BC036364 mRNA Translation: AAH36364.2
CCDSiCCDS13747.1 [P55957-2]
CCDS13748.1 [P55957-1]
CCDS13749.1 [P55957-4]
RefSeqiNP_001187.1, NM_001196.3 [P55957-1]
NP_001231496.1, NM_001244567.1 [P55957-1]
NP_001231498.1, NM_001244569.1 [P55957-4]
NP_001231499.1, NM_001244570.1 [P55957-4]
NP_001231501.1, NM_001244572.1 [P55957-4]
NP_932070.1, NM_197966.2 [P55957-2]
NP_932071.1, NM_197967.2 [P55957-4]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1ZY3NMR-B82-101[»]
2BIDNMR-A1-195[»]
2KBWNMR-B76-106[»]
2M5BNMR-B80-101[»]
2M5INMR-A61-195[»]
4BD2X-ray2.21C76-109[»]
4QVEX-ray2.05B76-109[»]
4ZEQX-ray1.80B79-104[»]
4ZIGX-ray2.20B79-98[»]
4ZIIX-ray2.19C76-109[»]
5AJJX-ray1.75B79-112[»]
5C3FX-ray1.43B80-101[»]
SMRiP55957
ModBaseiSearch...

Protein-protein interaction databases

BioGridi107106, 55 interactors
ComplexPortaliCPX-1984 BID:BCL-2 complex
CPX-1991 BID:BCL-XL complex
DIPiDIP-34937N
IntActiP55957, 39 interactors
MINTiP55957
STRINGi9606.ENSP00000318822

PTM databases

iPTMnetiP55957
PhosphoSitePlusiP55957

Polymorphism and mutation databases

BioMutaiBID
DMDMi2493285

2D gel databases

OGPiP55957

Proteomic databases

EPDiP55957
jPOSTiP55957
MassIVEiP55957
MaxQBiP55957
PaxDbiP55957
PeptideAtlasiP55957
PRIDEiP55957
ProteomicsDBi12613 [P55957-4]
56882 [P55957-1]
56883 [P55957-2]
56884 [P55957-3]
56885 [P55957-4]
TopDownProteomicsiP55957-1 [P55957-1]
P55957-4 [P55957-4]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
637
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317361; ENSP00000318822; ENSG00000015475 [P55957-2]
ENST00000342111; ENSP00000344594; ENSG00000015475 [P55957-3]
ENST00000399765; ENSP00000382667; ENSG00000015475 [P55957-4]
ENST00000399767; ENSP00000382669; ENSG00000015475 [P55957-4]
ENST00000399774; ENSP00000382674; ENSG00000015475 [P55957-1]
ENST00000551952; ENSP00000449236; ENSG00000015475 [P55957-1]
ENST00000611040; ENSP00000483709; ENSG00000015475 [P55957-4]
ENST00000614949; ENSP00000477773; ENSG00000015475 [P55957-4]
ENST00000615414; ENSP00000483534; ENSG00000015475 [P55957-4]
ENST00000622694; ENSP00000480414; ENSG00000015475 [P55957-1]
GeneIDi637
KEGGihsa:637
UCSCiuc002znc.3 human [P55957-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
637
DisGeNETi637

GeneCards: human genes, protein and diseases

More...
GeneCardsi
BID
HGNCiHGNC:1050 BID
HPAiCAB003771
HPA000722
MIMi601997 gene
neXtProtiNX_P55957
OpenTargetsiENSG00000015475
PharmGKBiPA25353

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IVZ7 Eukaryota
ENOG410ZF8F LUCA
GeneTreeiENSGT00390000002868
HOGENOMiHOG000010016
InParanoidiP55957
KOiK04726
OMAiFRTTVNF
OrthoDBi1218538at2759
PhylomeDBiP55957
TreeFamiTF102047

Enzyme and pathway databases

ReactomeiR-HSA-111447 Activation of BAD and translocation to mitochondria
R-HSA-111452 Activation and oligomerization of BAK protein
R-HSA-111453 BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
R-HSA-114294 Activation, translocation and oligomerization of BAX
R-HSA-6803204 TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
R-HSA-75108 Activation, myristolyation of BID and translocation to mitochondria
SIGNORiP55957

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
BID human
EvolutionaryTraceiP55957

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
BH3_interacting-domain_death_agonist
BH3_interacting_domain_death_agonist

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
637

Pharos

More...
Pharosi
P55957
PMAP-CutDBiP55957

Protein Ontology

More...
PROi
PR:P55957

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000015475 Expressed in 194 organ(s), highest expression level in blood
ExpressionAtlasiP55957 baseline and differential
GenevisibleiP55957 HS

Family and domain databases

Gene3Di1.10.437.10, 1 hit
InterProiView protein in InterPro
IPR020728 Bcl2_BH3_motif_CS
IPR010479 BID
IPR036834 Blc2-like_sf
PANTHERiPTHR35447 PTHR35447, 1 hit
PfamiView protein in Pfam
PF06393 BID, 1 hit
PIRSFiPIRSF038018 BID, 1 hit
SUPFAMiSSF56854 SSF56854, 1 hit
PROSITEiView protein in PROSITE
PS01259 BH3, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBID_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P55957
Secondary accession number(s): Q549M7
, Q71T04, Q7Z4M9, Q8IY86
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: September 18, 2019
This is version 196 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again