Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BH3-interacting domain death agonist

Gene

BID

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

The major proteolytic product p15 BID allows the release of cytochrome c (By similarity). Isoform 1, isoform 2 and isoform 4 induce ICE-like proteases and apoptosis. Isoform 3 does not induce apoptosis. Counters the protective effect of Bcl-2.By similarity1 Publication

GO - Molecular functioni

  • death receptor binding Source: ProtInc
  • protein heterodimerization activity Source: Ensembl
  • ubiquitin protein ligase binding Source: Ensembl

GO - Biological processi

Keywordsi

Biological processApoptosis

Enzyme and pathway databases

ReactomeiR-HSA-111447 Activation of BAD and translocation to mitochondria
R-HSA-111452 Activation and oligomerization of BAK protein
R-HSA-111453 BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members
R-HSA-114294 Activation, translocation and oligomerization of BAX
R-HSA-6803204 TP53 Regulates Transcription of Genes Involved in Cytochrome C Release
R-HSA-75108 Activation, myristolyation of BID and translocation to mitochondria
SIGNORiP55957

Names & Taxonomyi

Protein namesi
Recommended name:
BH3-interacting domain death agonist
Alternative name(s):
p22 BID
Short name:
BID
Cleaved into the following 3 chains:
Alternative name(s):
p15 BID
Alternative name(s):
p13 BID
Alternative name(s):
p11 BID
Gene namesi
Name:BID
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000015475.18
HGNCiHGNC:1050 BID
MIMi601997 gene
neXtProtiNX_P55957

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Membrane, Mitochondrion

Pathology & Biotechi

Organism-specific databases

DisGeNETi637
OpenTargetsiENSG00000015475
PharmGKBiPA25353

Polymorphism and mutation databases

BioMutaiBID
DMDMi2493285

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001431011 – 195BH3-interacting domain death agonistAdd BLAST195
ChainiPRO_000022323362 – 195BH3-interacting domain death agonist p15By similarityAdd BLAST134
ChainiPRO_000022323277 – 195BH3-interacting domain death agonist p13By similarityAdd BLAST119
ChainiPRO_0000223231100 – 195BH3-interacting domain death agonist p11By similarityAdd BLAST96

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei54PhosphotyrosineCombined sources1
Modified residuei78PhosphoserineCombined sources1

Post-translational modificationi

TNF-alpha induces a caspase-mediated cleavage of p22 BID into a major p15 and minor p13 and p11 products.By similarity
p15 BID is ubiquitinated by ITCH; ubiquitination results in proteasome-dependent degradation.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei61 – 62CleavageBy similarity2
Sitei76 – 77CleavageBy similarity2
Sitei99 – 100CleavageBy similarity2

Keywords - PTMi

Acetylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiP55957
MaxQBiP55957
PaxDbiP55957
PeptideAtlasiP55957
PRIDEiP55957
ProteomicsDBi12613 [P55957-4]
56882
56883 [P55957-2]
56884 [P55957-3]
56885 [P55957-4]
TopDownProteomicsiP55957-1 [P55957-1]
P55957-4 [P55957-4]

2D gel databases

OGPiP55957

PTM databases

iPTMnetiP55957
PhosphoSitePlusiP55957

Miscellaneous databases

PMAP-CutDBiP55957

Expressioni

Tissue specificityi

Isoform 2 and isoform 3 are expressed in spleen, bone marrow, cerebral and cerebellar cortex. Isoform 2 is expressed in spleen, pancreas and placenta (at protein level). Isoform 3 is expressed in lung, pancreas and spleen (at protein level). Isoform 4 is expressed in lung and pancreas (at protein level).1 Publication

Gene expression databases

BgeeiENSG00000015475
CleanExiHS_BID
ExpressionAtlasiP55957 baseline and differential
GenevisibleiP55957 HS

Organism-specific databases

HPAiCAB003771
HPA000722

Interactioni

Subunit structurei

Forms heterodimers either with the pro-apoptotic protein BAX or the anti-apoptotic protein Bcl-2 (By similarity). p15 BID interacts with ITCH.By similarity1 Publication

Binary interactionsi

Show more details

GO - Molecular functioni

  • death receptor binding Source: ProtInc
  • protein heterodimerization activity Source: Ensembl
  • ubiquitin protein ligase binding Source: Ensembl

Protein-protein interaction databases

BioGridi107106, 55 interactors
ComplexPortaliCPX-1984 BID:BCL-2 complex
CPX-1991 BID:BCL-XL complex
CORUMiP55957
DIPiDIP-34937N
IntActiP55957, 37 interactors
MINTiP55957
STRINGi9606.ENSP00000318822

Structurei

Secondary structure

1195
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi15 – 27Combined sources13
Beta strandi31 – 33Combined sources3
Helixi34 – 40Combined sources7
Helixi41 – 43Combined sources3
Helixi81 – 100Combined sources20
Turni102 – 105Combined sources4
Helixi106 – 114Combined sources9
Helixi116 – 118Combined sources3
Helixi119 – 135Combined sources17
Helixi145 – 162Combined sources18
Helixi167 – 179Combined sources13
Turni180 – 182Combined sources3
Helixi183 – 191Combined sources9

3D structure databases

ProteinModelPortaliP55957
SMRiP55957
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP55957

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi86 – 100BH3Add BLAST15

Domaini

Intact BH3 motif is required by BIK, BID, BAK, BAD and BAX for their pro-apoptotic activity and for their interaction with anti-apoptotic members of the Bcl-2 family.

Phylogenomic databases

eggNOGiENOG410IVZ7 Eukaryota
ENOG410ZF8F LUCA
GeneTreeiENSGT00390000002868
HOGENOMiHOG000010016
HOVERGENiHBG001703
InParanoidiP55957
KOiK04726
OMAiRDVFRTT
OrthoDBiEOG091G0LRX
PhylomeDBiP55957
TreeFamiTF102047

Family and domain databases

Gene3Di1.10.437.10, 1 hit
InterProiView protein in InterPro
IPR020728 Bcl2_BH3_motif_CS
IPR010479 BID
IPR036834 Blc2-like_sf
PANTHERiPTHR35447 PTHR35447, 1 hit
PfamiView protein in Pfam
PF06393 BID, 1 hit
PIRSFiPIRSF038018 BID, 1 hit
SUPFAMiSSF56854 SSF56854, 1 hit
PROSITEiView protein in PROSITE
PS01259 BH3, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: P55957-1) [UniParc]FASTAAdd to basket
Also known as: BID(L)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDCEVNNGSS LRDECITNLL VFGFLQSCSD NSFRRELDAL GHELPVLAPQ
60 70 80 90 100
WEGYDELQTD GNRSSHSRLG RIEADSESQE DIIRNIARHL AQVGDSMDRS
110 120 130 140 150
IPPGLVNGLA LQLRNTSRSE EDRNRDLATA LEQLLQAYPR DMEKEKTMLV
160 170 180 190
LALLLAKKVA SHTPSLLRDV FHTTVNFINQ NLRTYVRSLA RNGMD
Length:195
Mass (Da):21,995
Last modified:November 1, 1997 - v1
Checksum:iB17A07334C1AFBEF
GO
Isoform 2 (identifier: P55957-2) [UniParc]FASTAAdd to basket
Also known as: BID(EL)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MCSGAGVMMARWAARGRAGWRSTVRILSPLGHCEPGVSRSCRAAQAM

Show »
Length:241
Mass (Da):26,836
Checksum:i437706F65542B380
GO
Isoform 3 (identifier: P55957-3) [UniParc]FASTAAdd to basket
Also known as: BID(S)

The sequence of this isoform differs from the canonical sequence as follows:
     75-137: DSESQEDIIR...ATALEQLLQA → GASDNNTASA...AWTVASLRAW
     138-195: Missing.

Show »
Length:137
Mass (Da):14,620
Checksum:i00B4D060E01FA1B8
GO
Isoform 4 (identifier: P55957-4) [UniParc]FASTAAdd to basket
Also known as: BID(ES)

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: Missing.

Show »
Length:99
Mass (Da):11,263
Checksum:i482F50C9C7DF86B0
GO

Sequence cautioni

The sequence AAH22072 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01884510S → G1 PublicationCorresponds to variant dbSNP:rs8190315Ensembl.1
Natural variantiVAR_025332162H → Q1 PublicationCorresponds to variant dbSNP:rs17853595Ensembl.1
Natural variantiVAR_061041194M → T. Corresponds to variant dbSNP:rs59225839Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0172661 – 96Missing in isoform 4. 1 PublicationAdd BLAST96
Alternative sequenceiVSP_0172671M → MCSGAGVMMARWAARGRAGW RSTVRILSPLGHCEPGVSRS CRAAQAM in isoform 2. 2 Publications1
Alternative sequenceiVSP_01726875 – 137DSESQ…QLLQA → GASDNNTASAEEETEAAGSV AVERGLHGAATVILKVKKTS SGILPGTSPRSGTAWTVASL RAW in isoform 3. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_017269138 – 195Missing in isoform 3. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF042083 mRNA Translation: AAC34365.1
AF250233 mRNA Translation: AAO32633.1
AY005151 mRNA Translation: AAF89091.1
AF087891 mRNA Translation: AAP97190.1
CR456389 mRNA Translation: CAG30275.1
CR407603 mRNA Translation: CAG28531.1
AY309922 Genomic DNA Translation: AAP50259.1
BC009197 mRNA Translation: AAH09197.1
BC022072 mRNA Translation: AAH22072.2 Different initiation.
BC033634 mRNA Translation: AAH33634.1
BC036364 mRNA Translation: AAH36364.2
CCDSiCCDS13747.1 [P55957-2]
CCDS13748.1 [P55957-1]
CCDS13749.1 [P55957-4]
RefSeqiNP_001187.1, NM_001196.3 [P55957-1]
NP_001231496.1, NM_001244567.1 [P55957-1]
NP_001231498.1, NM_001244569.1 [P55957-4]
NP_001231499.1, NM_001244570.1 [P55957-4]
NP_001231501.1, NM_001244572.1 [P55957-4]
NP_932070.1, NM_197966.2 [P55957-2]
NP_932071.1, NM_197967.2 [P55957-4]
UniGeneiHs.591054

Genome annotation databases

EnsembliENST00000317361; ENSP00000318822; ENSG00000015475 [P55957-2]
ENST00000342111; ENSP00000344594; ENSG00000015475 [P55957-3]
ENST00000399765; ENSP00000382667; ENSG00000015475 [P55957-4]
ENST00000399767; ENSP00000382669; ENSG00000015475 [P55957-4]
ENST00000399774; ENSP00000382674; ENSG00000015475 [P55957-1]
ENST00000551952; ENSP00000449236; ENSG00000015475 [P55957-1]
ENST00000611040; ENSP00000483709; ENSG00000015475 [P55957-4]
ENST00000614949; ENSP00000477773; ENSG00000015475 [P55957-4]
ENST00000615414; ENSP00000483534; ENSG00000015475 [P55957-4]
ENST00000622694; ENSP00000480414; ENSG00000015475 [P55957-1]
GeneIDi637
KEGGihsa:637
UCSCiuc002znc.3 human [P55957-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiBID_HUMAN
AccessioniPrimary (citable) accession number: P55957
Secondary accession number(s): Q549M7
, Q71T04, Q7Z4M9, Q8IY86
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: November 1, 1997
Last modified: July 18, 2018
This is version 186 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health