Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Small ubiquitin-related modifier 3

Gene

SUMO3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4 (PubMed:11451954, PubMed:18538659, PubMed:21965678). Plays a role in the regulation of sumoylation status of SETX (PubMed:24105744).3 Publications

GO - Molecular functioni

  • enzyme binding Source: CAFA
  • protein tag Source: GO_Central

GO - Biological processi

  • negative regulation of DNA binding Source: CAFA
  • protein sumoylation Source: UniProtKB

Keywordsi

Biological processUbl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-3065676 SUMO is conjugated to E1 (UBA2:SAE1)
R-HSA-3065678 SUMO is transferred from E1 to E2 (UBE2I, UBC9)
R-HSA-3065679 SUMO is proteolytically processed
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-3232118 SUMOylation of transcription factors
R-HSA-3899300 SUMOylation of transcription cofactors
R-HSA-4090294 SUMOylation of intracellular receptors
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-4615885 SUMOylation of DNA replication proteins
R-HSA-4755510 SUMOylation of immune response proteins
R-HSA-5696395 Formation of Incision Complex in GG-NER

Names & Taxonomyi

Protein namesi
Recommended name:
Small ubiquitin-related modifier 3Curated
Short name:
SUMO-3Curated
Alternative name(s):
SMT3 homolog 1Imported
SUMO-21 Publication
Ubiquitin-like protein SMT3A1 Publication
Short name:
Smt3A1 Publication
Gene namesi
Name:SUMO3Imported
Synonyms:SMT3A1 Publication, SMT3H1Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 21

Organism-specific databases

EuPathDBiHostDB:ENSG00000184900.15
HGNCiHGNC:11124 SUMO3
MIMi602231 gene
neXtProtiNX_P55854

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi11K → R: Abolishes the formation of poly(SUMO) chains. 1 Publication1
Mutagenesisi33I → A: Impaired interaction with USP25; when associated with A-34. 1 Publication1
Mutagenesisi34K → A: Impaired interaction with USP25; when associated with A-33. 1 Publication1

Organism-specific databases

DisGeNETi6612
OpenTargetsiENSG00000184900
PharmGKBiPA35973

Chemistry databases

ChEMBLiCHEMBL3885639

Polymorphism and mutation databases

BioMutaiSUMO3
DMDMi23503102

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000359571 – 92Small ubiquitin-related modifier 3Add BLAST92
PropeptideiPRO_000003595893 – 1032 PublicationsAdd BLAST11

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki5Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki7Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki11Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate
Cross-linki11Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Cross-linki92Glycyl lysine isopeptide (Gly-Lys) (interchain with K-? in acceptor proteins)

Post-translational modificationi

Polymeric chains can be formed through Lys-11 cross-linking.
Cleavage of precursor form by SENP1, SENP2 or SENP5 is necessary for function.2 Publications

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

EPDiP55854
MaxQBiP55854
PaxDbiP55854
PeptideAtlasiP55854
PRIDEiP55854
ProteomicsDBi56874
TopDownProteomicsiP55854-1 [P55854-1]

PTM databases

iPTMnetiP55854
PhosphoSitePlusiP55854

Expressioni

Tissue specificityi

Expressed predominantly in liver.1 Publication

Gene expression databases

BgeeiENSG00000184900 Expressed in 238 organ(s), highest expression level in endothelial cell
CleanExiHS_SUMO3
ExpressionAtlasiP55854 baseline and differential
GenevisibleiP55854 HS

Organism-specific databases

HPAiCAB012180
HPA042123
HPA048064

Interactioni

Subunit structurei

Covalently attached to a number of proteins. Interacts with ARNTL/BMAL1 (By similarity). Interacts with USP25 (via ts SIM domain); the interaction sumoylates USP25 and inhibits its ubiquitin hydrolyzing activity. Interacts with SAE2 and UBE2I.By similarity4 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi112496, 73 interactors
ComplexPortaliCPX-3045 activated SUMO3-E1 ligase complex
CPX-3050 sumoylated E2 ligase complex (SUMO3)
DIPiDIP-29255N
ELMiP55854
IntActiP55854, 63 interactors
MINTiP55854
STRINGi9606.ENSP00000330343

Structurei

Secondary structure

1103
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP55854
SMRiP55854
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP55854

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini15 – 92Ubiquitin-likePROSITE-ProRule annotationAdd BLAST78

Sequence similaritiesi

Belongs to the ubiquitin family. SUMO subfamily.Curated

Phylogenomic databases

eggNOGiKOG1769 Eukaryota
COG5227 LUCA
GeneTreeiENSGT00390000018808
HOGENOMiHOG000207495
HOVERGENiHBG053025
InParanoidiP55854
KOiK12160
OMAiKNQDDIC
PhylomeDBiP55854
TreeFamiTF315116

Family and domain databases

CDDicd01763 Sumo, 1 hit
InterProiView protein in InterPro
IPR022617 Rad60/SUMO-like_dom
IPR033950 Sumo
IPR029071 Ubiquitin-like_domsf
IPR000626 Ubiquitin_dom
PfamiView protein in Pfam
PF11976 Rad60-SLD, 1 hit
SMARTiView protein in SMART
SM00213 UBQ, 1 hit
SUPFAMiSSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50053 UBIQUITIN_2, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P55854-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSEEKPKEGV KTENDHINLK VAGQDGSVVQ FKIKRHTPLS KLMKAYCERQ
60 70 80 90 100
GLSMRQIRFR FDGQPINETD TPAQLEMEDE DTIDVFQQQT GGVPESSLAG

HSF
Length:103
Mass (Da):11,637
Last modified:September 19, 2002 - v2
Checksum:iE337E34CB5B3B187
GO
Isoform 2 (identifier: P55854-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-50: Q → QVRHLAPPQSLPVCALVLCVPGIPRARASRGWTQMQLPE

Note: No experimental confirmation available.
Show »
Length:141
Mass (Da):15,768
Checksum:iB4D3FDFE12CD6B12
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A8MU27A8MU27_HUMAN
Small ubiquitin-related modifier 3
SUMO3
147Annotation score:
A8MUA9A8MUA9_HUMAN
SMT3 suppressor of mif two 3 homolo...
SUMO3 hCG_401304
135Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti32K → E in BAD96311 (Ref. 5) Curated1
Sequence conflicti76E → R in CAA67896 (PubMed:9119407).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05269238P → S1 PublicationCorresponds to variant dbSNP:rs1051311Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05469350Q → QVRHLAPPQSLPVCALVLCV PGIPRARASRGWTQMQLPE in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X99584 mRNA Translation: CAA67896.1
BT007008 mRNA Translation: AAP35654.1
CR542173 mRNA Translation: CAG46970.1
CR542188 mRNA Translation: CAG46985.1
AK222591 mRNA Translation: BAD96311.1
AK300822 mRNA Translation: BAG62476.1
AK312350 mRNA Translation: BAG35271.1
AL773603 Genomic DNA No translation available.
CH471079 Genomic DNA Translation: EAX09392.1
BC000036 mRNA Translation: AAH00036.1
BC008420 mRNA Translation: AAH08420.1
CCDSiCCDS33587.1 [P55854-1]
CCDS68220.1 [P55854-2]
RefSeqiNP_001273345.1, NM_001286416.1 [P55854-2]
NP_008867.2, NM_006936.2 [P55854-1]
UniGeneiHs.474005

Genome annotation databases

EnsembliENST00000332859; ENSP00000330343; ENSG00000184900 [P55854-1]
ENST00000411651; ENSP00000409666; ENSG00000184900 [P55854-2]
GeneIDi6612
KEGGihsa:6612
UCSCiuc002zfz.1 human [P55854-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Wikipedia

SUMO protein entry

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X99584 mRNA Translation: CAA67896.1
BT007008 mRNA Translation: AAP35654.1
CR542173 mRNA Translation: CAG46970.1
CR542188 mRNA Translation: CAG46985.1
AK222591 mRNA Translation: BAD96311.1
AK300822 mRNA Translation: BAG62476.1
AK312350 mRNA Translation: BAG35271.1
AL773603 Genomic DNA No translation available.
CH471079 Genomic DNA Translation: EAX09392.1
BC000036 mRNA Translation: AAH00036.1
BC008420 mRNA Translation: AAH08420.1
CCDSiCCDS33587.1 [P55854-1]
CCDS68220.1 [P55854-2]
RefSeqiNP_001273345.1, NM_001286416.1 [P55854-2]
NP_008867.2, NM_006936.2 [P55854-1]
UniGeneiHs.474005

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1U4ANMR-A14-92[»]
2IO1X-ray2.60B/D/F14-103[»]
2MP2NMR-A12-92[»]
B2-90[»]
ProteinModelPortaliP55854
SMRiP55854
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112496, 73 interactors
ComplexPortaliCPX-3045 activated SUMO3-E1 ligase complex
CPX-3050 sumoylated E2 ligase complex (SUMO3)
DIPiDIP-29255N
ELMiP55854
IntActiP55854, 63 interactors
MINTiP55854
STRINGi9606.ENSP00000330343

Chemistry databases

ChEMBLiCHEMBL3885639

PTM databases

iPTMnetiP55854
PhosphoSitePlusiP55854

Polymorphism and mutation databases

BioMutaiSUMO3
DMDMi23503102

Proteomic databases

EPDiP55854
MaxQBiP55854
PaxDbiP55854
PeptideAtlasiP55854
PRIDEiP55854
ProteomicsDBi56874
TopDownProteomicsiP55854-1 [P55854-1]

Protocols and materials databases

DNASUi6612
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000332859; ENSP00000330343; ENSG00000184900 [P55854-1]
ENST00000411651; ENSP00000409666; ENSG00000184900 [P55854-2]
GeneIDi6612
KEGGihsa:6612
UCSCiuc002zfz.1 human [P55854-1]

Organism-specific databases

CTDi6612
DisGeNETi6612
EuPathDBiHostDB:ENSG00000184900.15
GeneCardsiSUMO3
HGNCiHGNC:11124 SUMO3
HPAiCAB012180
HPA042123
HPA048064
MIMi602231 gene
neXtProtiNX_P55854
OpenTargetsiENSG00000184900
PharmGKBiPA35973
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1769 Eukaryota
COG5227 LUCA
GeneTreeiENSGT00390000018808
HOGENOMiHOG000207495
HOVERGENiHBG053025
InParanoidiP55854
KOiK12160
OMAiKNQDDIC
PhylomeDBiP55854
TreeFamiTF315116

Enzyme and pathway databases

ReactomeiR-HSA-3065676 SUMO is conjugated to E1 (UBA2:SAE1)
R-HSA-3065678 SUMO is transferred from E1 to E2 (UBE2I, UBC9)
R-HSA-3065679 SUMO is proteolytically processed
R-HSA-3108214 SUMOylation of DNA damage response and repair proteins
R-HSA-3232118 SUMOylation of transcription factors
R-HSA-3899300 SUMOylation of transcription cofactors
R-HSA-4090294 SUMOylation of intracellular receptors
R-HSA-4551638 SUMOylation of chromatin organization proteins
R-HSA-4615885 SUMOylation of DNA replication proteins
R-HSA-4755510 SUMOylation of immune response proteins
R-HSA-5696395 Formation of Incision Complex in GG-NER

Miscellaneous databases

ChiTaRSiSUMO3 human
EvolutionaryTraceiP55854
GeneWikiiSUMO3
GenomeRNAii6612
PROiPR:P55854
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000184900 Expressed in 238 organ(s), highest expression level in endothelial cell
CleanExiHS_SUMO3
ExpressionAtlasiP55854 baseline and differential
GenevisibleiP55854 HS

Family and domain databases

CDDicd01763 Sumo, 1 hit
InterProiView protein in InterPro
IPR022617 Rad60/SUMO-like_dom
IPR033950 Sumo
IPR029071 Ubiquitin-like_domsf
IPR000626 Ubiquitin_dom
PfamiView protein in Pfam
PF11976 Rad60-SLD, 1 hit
SMARTiView protein in SMART
SM00213 UBQ, 1 hit
SUPFAMiSSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50053 UBIQUITIN_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiSUMO3_HUMAN
AccessioniPrimary (citable) accession number: P55854
Secondary accession number(s): B2R5X4
, B4DUW4, Q53HI9, Q6FGD4, Q9BWR4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: September 19, 2002
Last modified: November 7, 2018
This is version 173 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 21
    Human chromosome 21: entries, gene names and cross-references to MIM
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again