Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P55735 (SEC13_HUMAN)

Entry version 204 (02 Jun 2021)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Add a publicationFeedback
Protein

Protein SEC13 homolog

Gene

SEC13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a component of the nuclear pore complex (NPC) and the COPII coat. At the endoplasmic reticulum, SEC13 is involved in the biogenesis of COPII-coated vesicles (PubMed:8972206).

Required for the exit of adipsin (CFD/ADN), an adipocyte-secreted protein from the endoplasmic reticulum (By similarity).

By similarity1 Publication

As a component of the GATOR subcomplex GATOR2, functions within the amino acid-sensing branch of the TORC1 signaling pathway. Indirectly activates mTORC1 and the TORC1 signaling pathway through the inhibition of the GATOR1 subcomplex (PubMed:23723238).

It is negatively regulated by the upstream amino acid sensors SESN2 and CASTOR1 (PubMed:25457612, PubMed:27487210).

3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processER-Golgi transport, mRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P55735

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-1169408, ISG15 antiviral mechanism
R-HSA-141444, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-159227, Transport of the SLBP independent Mature mRNA
R-HSA-159230, Transport of the SLBP Dependant Mature mRNA
R-HSA-159231, Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-159236, Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-165054, Rev-mediated nuclear export of HIV RNA
R-HSA-168271, Transport of Ribonucleoproteins into the Host Nucleus
R-HSA-168276, NS1 Mediated Effects on Host Pathways
R-HSA-168325, Viral Messenger RNA Synthesis
R-HSA-168333, NEP/NS2 Interacts with the Cellular Export Machinery
R-HSA-170822, Regulation of Glucokinase by Glucokinase Regulatory Protein
R-HSA-180746, Nuclear import of Rev protein
R-HSA-180910, Vpr-mediated nuclear import of PICs
R-HSA-191859, snRNP Assembly
R-HSA-204005, COPII-mediated vesicle transport
R-HSA-2132295, MHC class II antigen presentation
R-HSA-2467813, Separation of Sister Chromatids
R-HSA-2500257, Resolution of Sister Chromatid Cohesion
R-HSA-3108214, SUMOylation of DNA damage response and repair proteins
R-HSA-3232142, SUMOylation of ubiquitinylation proteins
R-HSA-3301854, Nuclear Pore Complex (NPC) Disassembly
R-HSA-3371453, Regulation of HSF1-mediated heat shock response
R-HSA-4085377, SUMOylation of SUMOylation proteins
R-HSA-4551638, SUMOylation of chromatin organization proteins
R-HSA-4570464, SUMOylation of RNA binding proteins
R-HSA-4615885, SUMOylation of DNA replication proteins
R-HSA-5578749, Transcriptional regulation by small RNAs
R-HSA-5619107, Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
R-HSA-5663220, RHO GTPases Activate Formins
R-HSA-6784531, tRNA processing in the nucleus
R-HSA-68877, Mitotic Prometaphase
R-HSA-9609690, HCMV Early Events
R-HSA-9610379, HCMV Late Events
R-HSA-9615933, Postmitotic nuclear pore complex (NPC) reformation
R-HSA-9639288, Amino acids regulate mTORC1
R-HSA-9648025, EML4 and NUDC in mitotic spindle formation
R-HSA-983170, Antigen Presentation: Folding, assembly and peptide loading of class I MHC

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...SignaLinki		P55735

SIGNOR Signaling Network Open Resource

More...SIGNORi		P55735

Protein family/group databases

Transport Classification Database

More...TCDBi		1.I.1.1.3, the nuclear pore complex (npc) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein SEC13 homologCurated
Alternative name(s):
GATOR complex protein SEC13Curated
SEC13-like protein 1
SEC13-related protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SEC13
Synonyms:D3S1231E, SEC13A1 Publication, SEC13L1, SEC13R
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:10697, SEC13

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600152, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P55735

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000157020.17

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasmic vesicle, Endoplasmic reticulum, Lysosome, Membrane, Nuclear pore complex, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		6396

Open Targets

More...OpenTargetsi		ENSG00000157020

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA35620

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P55735, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		SEC13

Domain mapping of disease mutations (DMDM)

More...DMDMi		50403748

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources2 Publications
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000512032 – 322Protein SEC13 homologAdd BLAST321

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylvalineCombined sources1 Publication1
Modified residuei184PhosphoserineCombined sources1
Modified residuei309PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P55735

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P55735

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P55735

MaxQB - The MaxQuant DataBase

More...MaxQBi		P55735

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P55735

PeptideAtlas

More...PeptideAtlasi		P55735

PRoteomics IDEntifications database

More...PRIDEi		P55735

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		2150
56858 [P55735-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P55735

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P55735

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P55735

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000157020, Expressed in adenohypophysis and 248 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P55735, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P55735, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000157020, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

At the nuclear pore: component of the Y-shaped Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex includes NUP160, NUP133, NUP107, NUP98, NUP85, NUP43, NUP37, SEH1 and SEC13. At the COPII coat complex: interacts with SEC31A and SEC31B. Within the GATOR complex, component of the GATOR2 subcomplex, made of MIOS, SEC13, SEH1L, WDR24 and WDR59. The GATOR complex strongly interacts with RRAGA/RRAGC and RRAGB/RRAGC heterodimers (PubMed:14517296, PubMed:16495487, PubMed:16957052, PubMed:18160040, PubMed:23723238). The GATOR2 complex interacts with CASTOR2 and CASTOR1; the interaction is negatively regulated by arginine (PubMed:26972053). The GATOR2 complex interacts with SESN1, SESN2 and SESN3; the interaction is negatively regulated by amino acids (PubMed:25263562, PubMed:25457612).

Interacts with SEC16A (PubMed:17428803, PubMed:19638414, PubMed:25201882).

Interacts with SEC16B (PubMed:22355596).

12 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		112296, 140 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-6227, GATOR2 complex
CPX-873, Nuclear pore complex

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P55735

Database of interacting proteins

More...DIPi		DIP-39091N

Protein interaction database and analysis system

More...IntActi		P55735, 88 interactors

Molecular INTeraction database

More...MINTi		P55735

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000373312

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P55735, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1322
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P55735

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P55735

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati11 – 50WD 1Add BLAST40
Repeati55 – 96WD 2Add BLAST42
Repeati101 – 144WD 3Add BLAST44
Repeati148 – 204WD 4Add BLAST57
Repeati210 – 253WD 5Add BLAST44
Repeati260 – 299WD 6Add BLAST40

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the WD repeat SEC13 family.Curated

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1332, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000153393

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_032441_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P55735

Identification of Orthologs from Complete Genome Data

More...OMAi		REDNDRW

Database of Orthologous Groups

More...OrthoDBi		944756at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P55735

TreeFam database of animal gene trees

More...TreeFami		TF300815

Family and domain databases

Database of protein disorder

More...DisProti		DP01236

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.130.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR037596, Sec13
IPR037363, Sec13/Seh1_fam
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR017986, WD40_repeat_dom
IPR036322, WD40_repeat_dom_sf

The PANTHER Classification System

More...PANTHERi		PTHR11024, PTHR11024, 1 hit
PTHR11024:SF2, PTHR11024:SF2, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00400, WD40, 5 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00320, WD40, 6 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50978, SSF50978, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50082, WD_REPEATS_2, 3 hits
PS50294, WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P55735-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVSVINTVDT SHEDMIHDAQ MDYYGTRLAT CSSDRSVKIF DVRNGGQILI 
        60         70         80         90        100
ADLRGHEGPV WQVAWAHPMY GNILASCSYD RKVIIWREEN GTWEKSHEHA 
       110        120        130        140        150
GHDSSVNSVC WAPHDYGLIL ACGSSDGAIS LLTYTGEGQW EVKKINNAHT 
       160        170        180        190        200
IGCNAVSWAP AVVPGSLIDH PSGQKPNYIK RFASGGCDNL IKLWKEEEDG 
       210        220        230        240        250
QWKEEQKLEA HSDWVRDVAW APSIGLPTST IASCSQDGRV FIWTCDDASS 
       260        270        280        290        300
NTWSPKLLHK FNDVVWHVSW SITANILAVS GGDNKVTLWK ESVDGQWVCI 
       310        320 
SDVNKGQGSV SASVTEGQQN EQ
Length:322
Mass (Da):35,541
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i18E29627D87FB3DD
GO
Isoform 2 (identifier: P55735-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: Missing.

Show »
Length:308
Mass (Da):34,012
Checksum:iF4D5BC3F757FE7BB
GO
Isoform 3 (identifier: P55735-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MREPVLTWCVPLELLCSHPLPLSAFLKSQVKLYTYRACAGKDEMGKM

Show »
Length:368
Mass (Da):40,747
Checksum:iE738D9D307CF2308
GO
Isoform 4 (identifier: P55735-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGKM

Show »
Length:325
Mass (Da):35,857
Checksum:iFF2931B0935BA1FB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A8MXL6A8MXL6_HUMAN
GATOR complex protein SEC13
SEC13
284Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ERC8E7ERC8_HUMAN
GATOR complex protein SEC13
SEC13
86Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J0S2C9J0S2_HUMAN
Protein SEC13 homolog
SEC13
28Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JIB6C9JIB6_HUMAN
Protein SEC13 homolog
SEC13
24Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JBJ5C9JBJ5_HUMAN
Protein SEC13 homolog
SEC13
27Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti51A → V in L09260 (PubMed:7987303).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_053413172S → L. Corresponds to variant dbSNP:rs34078590Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0461911 – 14Missing in isoform 2. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_0546951M → MREPVLTWCVPLELLCSHPL PLSAFLKSQVKLYTYRACAG KDEMGKM in isoform 3. 1 Publication1
Alternative sequenceiVSP_0589661M → MGKM in isoform 4. 1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
L09260 mRNA No translation available.
AF052155 mRNA No translation available.
AK301999 mRNA Translation: BAG63403.1
AC022384 Genomic DNA No translation available.
BC002634 mRNA Translation: AAH02634.2
BC006167 mRNA Translation: AAH06167.1
BC091506 mRNA Translation: AAH91506.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS2599.1 [P55735-1]
CCDS46751.1 [P55735-2]
CCDS63540.1 [P55735-3]

NCBI Reference Sequences

More...RefSeqi		NP_001129498.1, NM_001136026.2 [P55735-3]
NP_001129704.1, NM_001136232.2 [P55735-2]
NP_109598.2, NM_030673.3 [P55735-4]
NP_899195.1, NM_183352.2 [P55735-1]
XP_005265436.1, XM_005265379.2 [P55735-4]
XP_016862508.1, XM_017007019.1 [P55735-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000337354; ENSP00000336566; ENSG00000157020 [P55735-4]
ENST00000350697; ENSP00000312122; ENSG00000157020 [P55735-1]
ENST00000383801; ENSP00000373312; ENSG00000157020 [P55735-3]
ENST00000397109; ENSP00000380298; ENSG00000157020 [P55735-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		6396

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:6396

UCSC genome browser

More...UCSCi		uc003bvm.5, human [P55735-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L09260 mRNA No translation available.
AF052155 mRNA No translation available.
AK301999 mRNA Translation: BAG63403.1
AC022384 Genomic DNA No translation available.
BC002634 mRNA Translation: AAH02634.2
BC006167 mRNA Translation: AAH06167.1
BC091506 mRNA Translation: AAH91506.1
CCDSiCCDS2599.1 [P55735-1]
CCDS46751.1 [P55735-2]
CCDS63540.1 [P55735-3]
RefSeqiNP_001129498.1, NM_001136026.2 [P55735-3]
NP_001129704.1, NM_001136232.2 [P55735-2]
NP_109598.2, NM_030673.3 [P55735-4]
NP_899195.1, NM_183352.2 [P55735-1]
XP_005265436.1, XM_005265379.2 [P55735-4]
XP_016862508.1, XM_017007019.1 [P55735-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3BG0X-ray3.15A/D/E/H1-316[»]
3BG1X-ray3.00A/D/E/H1-316[»]
5A9Qelectron microscopy23.006/F/O/X1-322[»]
SMRiP55735
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi112296, 140 interactors
ComplexPortaliCPX-6227, GATOR2 complex
CPX-873, Nuclear pore complex
CORUMiP55735
DIPiDIP-39091N
IntActiP55735, 88 interactors
MINTiP55735
STRINGi9606.ENSP00000373312

Protein family/group databases

TCDBi1.I.1.1.3, the nuclear pore complex (npc) family

PTM databases

iPTMnetiP55735
PhosphoSitePlusiP55735
SwissPalmiP55735

Genetic variation databases

BioMutaiSEC13
DMDMi50403748

Proteomic databases

EPDiP55735
jPOSTiP55735
MassIVEiP55735
MaxQBiP55735
PaxDbiP55735
PeptideAtlasiP55735
PRIDEiP55735
ProteomicsDBi2150
56858 [P55735-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		25962, 240 antibodies

The DNASU plasmid repository

More...DNASUi		6396

Genome annotation databases

EnsembliENST00000337354; ENSP00000336566; ENSG00000157020 [P55735-4]
ENST00000350697; ENSP00000312122; ENSG00000157020 [P55735-1]
ENST00000383801; ENSP00000373312; ENSG00000157020 [P55735-3]
ENST00000397109; ENSP00000380298; ENSG00000157020 [P55735-2]
GeneIDi6396
KEGGihsa:6396
UCSCiuc003bvm.5, human [P55735-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		6396
DisGeNETi6396

GeneCards: human genes, protein and diseases

More...GeneCardsi		SEC13
HGNCiHGNC:10697, SEC13
HPAiENSG00000157020, Low tissue specificity
MIMi600152, gene
neXtProtiNX_P55735
OpenTargetsiENSG00000157020
PharmGKBiPA35620
VEuPathDBiHostDB:ENSG00000157020.17

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1332, Eukaryota
GeneTreeiENSGT00940000153393
HOGENOMiCLU_032441_0_1_1
InParanoidiP55735
OMAiREDNDRW
OrthoDBi944756at2759
PhylomeDBiP55735
TreeFamiTF300815

Enzyme and pathway databases

PathwayCommonsiP55735
ReactomeiR-HSA-1169408, ISG15 antiviral mechanism
R-HSA-141444, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
R-HSA-159227, Transport of the SLBP independent Mature mRNA
R-HSA-159230, Transport of the SLBP Dependant Mature mRNA
R-HSA-159231, Transport of Mature mRNA Derived from an Intronless Transcript
R-HSA-159236, Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-165054, Rev-mediated nuclear export of HIV RNA
R-HSA-168271, Transport of Ribonucleoproteins into the Host Nucleus
R-HSA-168276, NS1 Mediated Effects on Host Pathways
R-HSA-168325, Viral Messenger RNA Synthesis
R-HSA-168333, NEP/NS2 Interacts with the Cellular Export Machinery
R-HSA-170822, Regulation of Glucokinase by Glucokinase Regulatory Protein
R-HSA-180746, Nuclear import of Rev protein
R-HSA-180910, Vpr-mediated nuclear import of PICs
R-HSA-191859, snRNP Assembly
R-HSA-204005, COPII-mediated vesicle transport
R-HSA-2132295, MHC class II antigen presentation
R-HSA-2467813, Separation of Sister Chromatids
R-HSA-2500257, Resolution of Sister Chromatid Cohesion
R-HSA-3108214, SUMOylation of DNA damage response and repair proteins
R-HSA-3232142, SUMOylation of ubiquitinylation proteins
R-HSA-3301854, Nuclear Pore Complex (NPC) Disassembly
R-HSA-3371453, Regulation of HSF1-mediated heat shock response
R-HSA-4085377, SUMOylation of SUMOylation proteins
R-HSA-4551638, SUMOylation of chromatin organization proteins
R-HSA-4570464, SUMOylation of RNA binding proteins
R-HSA-4615885, SUMOylation of DNA replication proteins
R-HSA-5578749, Transcriptional regulation by small RNAs
R-HSA-5619107, Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)
R-HSA-5663220, RHO GTPases Activate Formins
R-HSA-6784531, tRNA processing in the nucleus
R-HSA-68877, Mitotic Prometaphase
R-HSA-9609690, HCMV Early Events
R-HSA-9610379, HCMV Late Events
R-HSA-9615933, Postmitotic nuclear pore complex (NPC) reformation
R-HSA-9639288, Amino acids regulate mTORC1
R-HSA-9648025, EML4 and NUDC in mitotic spindle formation
R-HSA-983170, Antigen Presentation: Folding, assembly and peptide loading of class I MHC
SignaLinkiP55735
SIGNORiP55735

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		6396, 758 hits in 965 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		SEC13, human
EvolutionaryTraceiP55735

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		SEC13

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		6396
PharosiP55735, Tbio

Protein Ontology

More...PROi		PR:P55735
RNActiP55735, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000157020, Expressed in adenohypophysis and 248 other tissues
ExpressionAtlasiP55735, baseline and differential
GenevisibleiP55735, HS

Family and domain databases

DisProtiDP01236
Gene3Di2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR037596, Sec13
IPR037363, Sec13/Seh1_fam
IPR015943, WD40/YVTN_repeat-like_dom_sf
IPR001680, WD40_repeat
IPR017986, WD40_repeat_dom
IPR036322, WD40_repeat_dom_sf
PANTHERiPTHR11024, PTHR11024, 1 hit
PTHR11024:SF2, PTHR11024:SF2, 1 hit
PfamiView protein in Pfam
PF00400, WD40, 5 hits
SMARTiView protein in SMART
SM00320, WD40, 6 hits
SUPFAMiSSF50978, SSF50978, 1 hit
PROSITEiView protein in PROSITE
PS50082, WD_REPEATS_2, 3 hits
PS50294, WD_REPEATS_REGION, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSEC13_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P55735
Secondary accession number(s): A8MV37
, B4DXJ1, Q5BJF0, Q9BRM6, Q9BUG7
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 1, 1997
Last sequence update: January 23, 2007
Last modified: June 2, 2021
This is version 204 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again