UniProtKB - P55734 (YGAP_ECOLI)

BLAST

>sp|P55734|YGAP_ECOLI Inner membrane protein YgaP OS=Escherichia coli (strain K12) OX=83333 GN=ygaP PE=1 SV=1
MALTTISPHDAQELIARGAKLIDIRDADEYLREHIPEADLAPLSVLEQSGLPAKLRHEQI
IFHCQAGKRTSNNADKLAAIAAPAEIFLLEDGIDGWKKAGLPVAVNKSQPLPLMRQVQIA
AGGLILIGVVLGYTVNSGFFLLSGFVGAGLLFAGISGFCGMARLLDKMPWNQRA

Align
Format
Add to basket Added to basket
History
Entry version 116 (28 Mar 2018)
Sequence version 1 (01 Nov 1997)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Inner membrane protein YgaP

Gene

ygaP

Organism

Escherichia coli (strain K12)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

GO - Molecular functionⁱ

thiosulfate sulfurtransferase activity
Source: EcoCyc
Inferred from direct assayⁱ
- 24958726
- 25204500

View the complete GO annotation on QuickGO ...

Enzyme and pathway databases

BioCycⁱ	EcoCyc:G7398-MONOMER MetaCyc:G7398-MONOMER

BioCycⁱ

EcoCyc:G7398-MONOMER
MetaCyc:G7398-MONOMER

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Inner membrane protein YgaP
Gene namesⁱ	Name:ygaP Ordered Locus Names:b2668, JW2643
Organismⁱ	Escherichia coli (strain K12)
Taxonomic identifierⁱ	83333 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Bacteria › Proteobacteria › Gammaproteobacteria › Enterobacterales › Enterobacteriaceae › Escherichia › Escherichia coli
Proteomesⁱ	UP000000318 Componentⁱ: Chromosome UP000000625 Componentⁱ: Chromosome

Organism-specific databases

EcoGeneⁱ	EG13288 ygaP

EcoGeneⁱ

EG13288 ygaP

Subcellular locationⁱ

Cell inner membrane ; Multi-pass membrane protein

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	1 – 116	CytoplasmicSequence analysisAdd BLAST	116
Transmembraneⁱ	117 – 137	HelicalSequence analysisAdd BLAST	21
Transmembraneⁱ	138 – 158	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	159 – 174	CytoplasmicSequence analysisAdd BLAST	16

GO - Cellular componentⁱ

integral component of plasma membrane
Source: EcoCyc
Inferred from direct assayⁱ
- 15919996

View the complete GO annotation on QuickGO ...

Keywords - Cellular componentⁱ

Cell inner membrane, Cell membrane, Membrane

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000169300	1 – 174	Inner membrane protein YgaPAdd BLAST		174

Proteomic databases

PaxDbⁱ	P55734
PRIDEⁱ	P55734

Interactionⁱ

Protein-protein interaction databases

BioGridⁱ	4262267, 14 interactors
IntActⁱ	P55734, 4 interactors
STRINGⁱ	316385.ECDH10B_2835

Structureⁱ

Secondary structure

Legend: HelixTurnBeta strandPDB Structure known for this area

Feature key	Position(s)	DescriptionActions	Length
Beta strandⁱ	4 – 6	Combined sources	3
Helixⁱ	8 – 16	Combined sources	9
Beta strandⁱ	20 – 23	Combined sources	4
Helixⁱ	27 – 32	Combined sources	6
Beta strandⁱ	36 – 38	Combined sources	3
Helixⁱ	43 – 49	Combined sources	7
Helixⁱ	53 – 55	Combined sources	3
Beta strandⁱ	58 – 63	Combined sources	6
Beta strandⁱ	65 – 67	Combined sources	3
Helixⁱ	68 – 72	Combined sources	5
Helixⁱ	74 – 80	Combined sources	7
Turnⁱ	81 – 83	Combined sources	3
Beta strandⁱ	84 – 89	Combined sources	6
Helixⁱ	92 – 98	Combined sources	7
Beta strandⁱ	104 – 106	Combined sources	3
Helixⁱ	116 – 137	Combined sources	22
Turnⁱ	138 – 141	Combined sources	4
Beta strandⁱ	142 – 145	Combined sources	4
Helixⁱ	146 – 167	Combined sources	22
Helixⁱ	171 – 173	Combined sources	3

Show more details

3D structure databases

ProteinModelPortalⁱ	P55734
SMRⁱ	P55734
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	15 – 105	RhodanesePROSITE-ProRule annotationAdd BLAST		91

Sequence similaritiesⁱ

To Synechocystis PCC 6803 slr1261.Curated

Keywords - Domainⁱ

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	ENOG4108V62 Bacteria COG0607 LUCA
HOGENOMⁱ	HOG000252161
InParanoidⁱ	P55734
OMAⁱ	TCAMGML
PhylomeDBⁱ	P55734

Family and domain databases

Gene3Dⁱ	3.40.250.10, 1 hit
InterProⁱ	View protein in InterPro IPR021309 DUF2892 IPR001763 Rhodanese-like_dom IPR036873 Rhodanese-like_dom_sf
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF11127 DUF2892, 1 hit PF00581 Rhodanese, 1 hit
SMARTⁱ	View protein in SMART SM00450 RHOD, 1 hit
SUPFAMⁱ	SSF52821 SSF52821, 1 hit
PROSITEⁱ	View protein in PROSITE PS50206 RHODANESE_3, 1 hit

Sequenceⁱ

Sequence statusⁱ: Complete.

P55734-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MALTTISPHD AQELIARGAK LIDIRDADEY LREHIPEADL APLSVLEQSG 
        60         70         80         90        100
LPAKLRHEQI IFHCQAGKRT SNNADKLAAI AAPAEIFLLE DGIDGWKKAG 
       110        120        130        140        150
LPVAVNKSQP LPLMRQVQIA AGGLILIGVV LGYTVNSGFF LLSGFVGAGL 
       160        170 
LFAGISGFCG MARLLDKMPW NQRA

Length:174

Mass (Da):18,639

Last modified:November 1, 1997 - v1

Checksum:ⁱ8B8C923A6F845E1E

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U00096 Genomic DNA Translation: AAC75715.1 AP009048 Genomic DNA Translation: BAE76780.1 X69210 Genomic DNA No translation available.
PIRⁱ	E65046
NCBI Reference Sequences More...RefSeqⁱ	NP_417154.1, NC_000913.3 WP_001229442.1, NZ_LN832404.1

Genome annotation databases

EnsemblBacteriaⁱ	AAC75715; AAC75715; b2668 BAE76780; BAE76780; BAE76780
GeneIDⁱ	947135
KEGGⁱ	ecj:JW2643 eco:b2668
PATRICⁱ	fig\|1411691.4.peg.4073

Protein	Similar proteins		Species	Score	Length	Source
P55734	Inner membrane protein YgaP		ECOLX		174	UniRef100_P55734
Predicted inner membrane protein with hydrolase activity		ECOLW		174
Uncharacterized protein		SHIBO		174
Inner membrane protein YgaP		Escherichia coli UMNK88		174
Uncharacterized protein		Escherichia coli MS 115-1		174
+18

Protein	Similar proteins		Species	Score	Length	Source
P55734	Inner membrane protein YgaP		ECOLX		174	UniRef90_P55734
Predicted inner membrane protein with hydrolase activity		ECOLW		174
Uncharacterized protein		SHIBO		174
Inner membrane protein YgaP		Escherichia coli UMNK88		174
Uncharacterized protein		Escherichia coli MS 115-1		174
+455

Protein	Similar proteins		Species	Score	Length	Source
P55734	Inner membrane protein YgaP		ECOLX		174	UniRef50_P55734
Predicted inner membrane protein with hydrolase activity		ECOLW		174
Uncharacterized protein		SHIBO		174
Inner membrane protein YgaP		Escherichia coli UMNK88		174
Uncharacterized protein		Escherichia coli MS 115-1		174
+713

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	U00096 Genomic DNA Translation: AAC75715.1 AP009048 Genomic DNA Translation: BAE76780.1 X69210 Genomic DNA No translation available.
PIRⁱ	E65046
RefSeqⁱ	NP_417154.1, NC_000913.3 WP_001229442.1, NZ_LN832404.1

3D structure databases

Select the link destinations: Protein Data Bank Europe More...PDBeⁱ Protein Data Bank RCSB More...RCSB PDBⁱ Protein Data Bank Japan More...PDBjⁱ Links Updated	PDB entry	Method	Resolution (Å)	Chain	Positions	PDBsum
	2MOI	NMR	-	A	2-109	[»]
	2MOL	NMR	-	A	2-109	[»]
	2MPN	NMR	-	A/B	107-174	[»]
	5HBL	X-ray	1.62	A	2-109	[»]
	5HBO	X-ray	1.66	A	2-109	[»]
	5HBP	X-ray	1.50	A	2-109	[»]
	5HBQ	X-ray	1.66	A	2-109	[»]
	5HPA	X-ray	1.66	A	2-109	[»]
	5LAM	NMR	-	A	2-109	[»]
	5LAO	NMR	-	A	2-109	[»]
ProteinModelPortalⁱ	P55734
SMRⁱ	P55734
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	4262267, 14 interactors
IntActⁱ	P55734, 4 interactors
STRINGⁱ	316385.ECDH10B_2835

Proteomic databases

PaxDbⁱ	P55734
PRIDEⁱ	P55734

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

EnsemblBacteriaⁱ	AAC75715; AAC75715; b2668 BAE76780; BAE76780; BAE76780
GeneIDⁱ	947135
KEGGⁱ	ecj:JW2643 eco:b2668
PATRICⁱ	fig\|1411691.4.peg.4073

Organism-specific databases

EchoBASEⁱ	EB3073
EcoGeneⁱ	EG13288 ygaP

Phylogenomic databases

eggNOGⁱ	ENOG4108V62 Bacteria COG0607 LUCA
HOGENOMⁱ	HOG000252161
InParanoidⁱ	P55734
OMAⁱ	TCAMGML
PhylomeDBⁱ	P55734

Enzyme and pathway databases

BioCycⁱ	EcoCyc:G7398-MONOMER MetaCyc:G7398-MONOMER

BioCycⁱ

EcoCyc:G7398-MONOMER
MetaCyc:G7398-MONOMER

Miscellaneous databases

Protein Ontology More...PROⁱ	PR:P55734

PROⁱ

PR:P55734

Family and domain databases

Gene3Dⁱ	3.40.250.10, 1 hit
InterProⁱ	View protein in InterPro IPR021309 DUF2892 IPR001763 Rhodanese-like_dom IPR036873 Rhodanese-like_dom_sf
Pfamⁱ	View protein in Pfam PF11127 DUF2892, 1 hit PF00581 Rhodanese, 1 hit
SMARTⁱ	View protein in SMART SM00450 RHOD, 1 hit
SUPFAMⁱ	SSF52821 SSF52821, 1 hit
PROSITEⁱ	View protein in PROSITE PS50206 RHODANESE_3, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	YGAP_ECOLI
Accessionⁱ	P55734Primary (citable) accession number: P55734 Secondary accession number(s): P76625, Q2MAC6
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	November 1, 1997
	Last sequence update:	November 1, 1997
	Last modified:	March 28, 2018
	This is version 116 of the entry and version 1 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Prokaryotic Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

3D-structure, Complete proteome, Reference proteome

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P55734 (YGAP_ECOLI)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Inner membrane protein YgaP

ygaP

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Enzyme and pathway databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

GO - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Proteomic databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Enzyme and pathway databases

Miscellaneous databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

GO - Cellular componentⁱ

PTM / Processingⁱ

Interactionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ