Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P55327 (TPD52_HUMAN)

Entry version 165 (10 Apr 2019)
Sequence version 2 (25 Nov 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Tumor protein D52

Gene

TPD52

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-432722 Golgi Associated Vesicle Biogenesis

SIGNOR Signaling Network Open Resource

More...SIGNORi		P55327

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tumor protein D52
Alternative name(s):
Protein N8
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TPD52
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000076554.15

Human Gene Nomenclature Database

More...HGNCi		HGNC:12005 TPD52

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		604068 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P55327

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		7163

Open Targets

More...OpenTargetsi		ENSG00000076554

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36686

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TPD52

Domain mapping of disease mutations (DMDM)

More...DMDMi		215273966

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001857381 – 224Tumor protein D52Add BLAST224

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei36PhosphoserineBy similarity1
Modified residuei40PhosphoserineBy similarity1
Modified residuei176PhosphoserineBy similarity1
Modified residuei223PhosphoserineCombined sources1

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P55327

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P55327

MaxQB - The MaxQuant DataBase

More...MaxQBi		P55327

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P55327

PeptideAtlas

More...PeptideAtlasi		P55327

PRoteomics IDEntifications database

More...PRIDEi		P55327

ProteomicsDB human proteome resource

More...ProteomicsDBi		56847
56848 [P55327-2]
56849 [P55327-3]
56850 [P55327-4]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		P55327-2 [P55327-2]
P55327-4 [P55327-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P55327

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P55327

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 2 is expressed in colon, breast, prostate, pancreas and kidney tumor cell lines. Isoform 2 is expressed at high levels in kidney, prostate, brain, small intestine and pancreas, at moderate levels in placenta and colon, at low levels in lung, liver and heart, and at very low levels in spleen, thymus, peripheral mononuclear blood cells, testis and ovary.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform 2 is expressed at lower levels in fetal brain and kidney than in adult brain and kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000076554 Expressed in 232 organ(s), highest expression level in frontal cortex

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P55327 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P55327 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA028427
HPA062167

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a homodimer or heterodimer with other members of the family. All isoforms interact with several 14-3-3 proteins.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		113016, 57 interactors

Protein interaction database and analysis system

More...IntActi		P55327, 17 interactors

Molecular INTeraction database

More...MINTi		P55327

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000429309

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		P55327

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P55327

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili62 – 114Sequence analysisAdd BLAST53

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TPD52 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4010 Eukaryota
ENOG4111M9H LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155294

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000231968

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG058643

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P55327

Identification of Orthologs from Complete Genome Data

More...OMAi		MDFYEDY

Database of Orthologous Groups

More...OrthoDBi		1225782at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P55327

TreeFam database of animal gene trees

More...TreeFami		TF317562

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007327 TPD52

The PANTHER Classification System

More...PANTHERi		PTHR19307 PTHR19307, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF04201 TPD52, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 8 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P55327-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDCREMDLYE DYQSPFDFDA GVNKSYLYLS PSGNSSPPGS PTLQKFGLLR 
        60         70         80         90        100
TDPVPEEGED VAATISATET LSEEEQEELR RELAKVEEEI QTLSQVLAAK 
       110        120        130        140        150
EKHLAEIKRK LGINSLQELK QNIAKGWQDV TATSAYKKTS ETLSQAGQKA 
       160        170        180        190        200
SAAFSSVGSV ITKKLEDVKN SPTFKSFEEK VENLKSKVGG TKPAGGDFGE 
       210        220 
VLNSAANASA TTTEPLPEKT QESL
Length:224
Mass (Da):24,327
Last modified:November 25, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4C8183C5914BB976
GO
Isoform 2 (identifier: P55327-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKF → MDRGEQ

Show »
Length:184
Mass (Da):19,863
Checksum:i4821EC86D1C3339D
GO
Isoform 3 (identifier: P55327-3) [UniParc]FASTAAdd to basket
Also known as: N8L

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MDCREMDLYE...PPGSPTLQKF → MTPRESAPGR...RAGDMDRGEQ

Show »
Length:248
Mass (Da):26,382
Checksum:iB7D203C4941A02B2
GO
Isoform 4 (identifier: P55327-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: MDCREMDLYEDYQSPFDFDAGVNKSYLYLSPSGNSSPPGSPTLQKF → MDRGEQ
     169-169: K → KLQAFSHSFSIRSIQHSISMPAMR

Note: No experimental confirmation available.
Show »
Length:207
Mass (Da):22,477
Checksum:i29027F1706989362
GO
Isoform 5 (identifier: P55327-5) [UniParc]FASTAAdd to basket
Also known as: PrLZ-238

The sequence of this isoform differs from the canonical sequence as follows:
     168-169: VK → VNIRSIQHSISMPAMR

Show »
Length:238
Mass (Da):25,922
Checksum:i8E02245A52BF64C7
GO
Isoform 6 (identifier: P55327-6) [UniParc]FASTAAdd to basket
Also known as: PrLZ-247

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: K → KLQAFSHSFSIRSIQHSISMPAMR

Show »
Length:247
Mass (Da):26,941
Checksum:iF9526200A91B6ABB
GO
Isoform 7 (identifier: P55327-7) [UniParc]FASTAAdd to basket
Also known as: PrLZ-233

The sequence of this isoform differs from the canonical sequence as follows:
     169-169: K → KLQAFSHSFR

Show »
Length:233
Mass (Da):25,401
Checksum:iA722640EFE14A677
GO
Isoform 8 (identifier: P55327-8) [UniParc]FASTAAdd to basket
Also known as: PrLZ-151

The sequence of this isoform differs from the canonical sequence as follows:
     136-224: YKKTSETLSQ...PLPEKTQESL → RSKLLAAETELLCLLY

Note: Interacts only with YWHAB and YWHAQ among 14-3-3 proteins.
Show »
Length:151
Mass (Da):16,853
Checksum:i5270A0BAF1F81B70
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YC44H0YC44_HUMAN
Tumor protein D52
TPD52
148Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RFR7E5RFR7_HUMAN
Tumor protein D52
TPD52
111Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RK35E5RK35_HUMAN
Tumor protein D52
TPD52
60Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RJ27E5RJ27_HUMAN
Tumor protein D52
TPD52
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGI1E5RGI1_HUMAN
Tumor protein D52
TPD52
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD97351 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti74E → K in BAD97351 (Ref. 9) Curated1
Sequence conflicti165L → P in CAG46831 (Ref. 6) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06186052D → Y. Corresponds to variant dbSNP:rs35099105Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0357511 – 46MDCRE…TLQKF → MDRGEQ in isoform 2 and isoform 4. 7 PublicationsAdd BLAST46
Alternative sequenceiVSP_0373781 – 46MDCRE…TLQKF → MTPRESAPGRGRAAPPRPTP LGVGTSRESPAEARRSSARR GGRSEPGRAAGGGAAEDTRR RAGDMDRGEQ in isoform 3. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_047718136 – 224YKKTS…TQESL → RSKLLAAETELLCLLY in isoform 8. 1 PublicationAdd BLAST89
Alternative sequenceiVSP_047719168 – 169VK → VNIRSIQHSISMPAMR in isoform 5. 1 Publication2
Alternative sequenceiVSP_043510169K → KLQAFSHSFSIRSIQHSISM PAMR in isoform 4 and isoform 6. 2 Publications1
Alternative sequenceiVSP_047720169K → KLQAFSHSFR in isoform 7. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U18914 mRNA Translation: AAC50183.1
S82081 mRNA Translation: AAB36475.1
AF202897 mRNA Translation: AAO22156.1
GQ499324 mRNA Translation: ACY08776.1
GQ499325 mRNA Translation: ACY08777.1
GQ499326 mRNA Translation: ACY08778.1
GQ499327 mRNA Translation: ACY08779.1
GQ499328 mRNA Translation: ACY08780.1
AK295468 mRNA Translation: BAH12078.1
AK296615 mRNA Translation: BAH12400.1
AK313135 mRNA Translation: BAG35954.1
CR542034 mRNA Translation: CAG46831.1
CR542064 mRNA Translation: CAG46861.1
BT019444 mRNA Translation: AAV38251.1
BX640835 mRNA Translation: CAE45908.1
AK223631 mRNA Translation: BAD97351.1 Different initiation.
AC009686 Genomic DNA No translation available.
AC018952 Genomic DNA No translation available.
AC036214 Genomic DNA No translation available.
AC104212 Genomic DNA No translation available.
CH471068 Genomic DNA Translation: EAW87074.1
BC018117 mRNA Translation: AAH18117.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS34912.1 [P55327-1]
CCDS47879.1 [P55327-4]
CCDS55249.1 [P55327-2]
CCDS75757.1 [P55327-5]
CCDS75758.1 [P55327-7]
CCDS75759.1 [P55327-6]

Protein sequence database of the Protein Information Resource

More...PIRi		I38910

NCBI Reference Sequences

More...RefSeqi		NP_001020423.1, NM_001025252.2 [P55327-1]
NP_001020424.1, NM_001025253.2 [P55327-4]
NP_001274069.1, NM_001287140.1 [P55327-6]
NP_001274071.1, NM_001287142.1 [P55327-5]
NP_001274072.1, NM_001287143.1 [P55327-7]
NP_001274073.1, NM_001287144.1
NP_005070.1, NM_005079.3 [P55327-2]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.368433

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000379096; ENSP00000368390; ENSG00000076554 [P55327-2]
ENST00000379097; ENSP00000368391; ENSG00000076554 [P55327-1]
ENST00000448733; ENSP00000410222; ENSG00000076554 [P55327-5]
ENST00000517427; ENSP00000429351; ENSG00000076554 [P55327-7]
ENST00000517462; ENSP00000429708; ENSG00000076554 [P55327-8]
ENST00000518937; ENSP00000429915; ENSG00000076554 [P55327-4]
ENST00000520527; ENSP00000429309; ENSG00000076554 [P55327-6]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7163

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7163

UCSC genome browser

More...UCSCi		uc003ybr.3 human [P55327-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U18914 mRNA Translation: AAC50183.1
S82081 mRNA Translation: AAB36475.1
AF202897 mRNA Translation: AAO22156.1
GQ499324 mRNA Translation: ACY08776.1
GQ499325 mRNA Translation: ACY08777.1
GQ499326 mRNA Translation: ACY08778.1
GQ499327 mRNA Translation: ACY08779.1
GQ499328 mRNA Translation: ACY08780.1
AK295468 mRNA Translation: BAH12078.1
AK296615 mRNA Translation: BAH12400.1
AK313135 mRNA Translation: BAG35954.1
CR542034 mRNA Translation: CAG46831.1
CR542064 mRNA Translation: CAG46861.1
BT019444 mRNA Translation: AAV38251.1
BX640835 mRNA Translation: CAE45908.1
AK223631 mRNA Translation: BAD97351.1 Different initiation.
AC009686 Genomic DNA No translation available.
AC018952 Genomic DNA No translation available.
AC036214 Genomic DNA No translation available.
AC104212 Genomic DNA No translation available.
CH471068 Genomic DNA Translation: EAW87074.1
BC018117 mRNA Translation: AAH18117.1
CCDSiCCDS34912.1 [P55327-1]
CCDS47879.1 [P55327-4]
CCDS55249.1 [P55327-2]
CCDS75757.1 [P55327-5]
CCDS75758.1 [P55327-7]
CCDS75759.1 [P55327-6]
PIRiI38910
RefSeqiNP_001020423.1, NM_001025252.2 [P55327-1]
NP_001020424.1, NM_001025253.2 [P55327-4]
NP_001274069.1, NM_001287140.1 [P55327-6]
NP_001274071.1, NM_001287142.1 [P55327-5]
NP_001274072.1, NM_001287143.1 [P55327-7]
NP_001274073.1, NM_001287144.1
NP_005070.1, NM_005079.3 [P55327-2]
UniGeneiHs.368433

3D structure databases

ProteinModelPortaliP55327
SMRiP55327
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113016, 57 interactors
IntActiP55327, 17 interactors
MINTiP55327
STRINGi9606.ENSP00000429309

PTM databases

iPTMnetiP55327
PhosphoSitePlusiP55327

Polymorphism and mutation databases

BioMutaiTPD52
DMDMi215273966

Proteomic databases

EPDiP55327
jPOSTiP55327
MaxQBiP55327
PaxDbiP55327
PeptideAtlasiP55327
PRIDEiP55327
ProteomicsDBi56847
56848 [P55327-2]
56849 [P55327-3]
56850 [P55327-4]
TopDownProteomicsiP55327-2 [P55327-2]
P55327-4 [P55327-4]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		7163
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000379096; ENSP00000368390; ENSG00000076554 [P55327-2]
ENST00000379097; ENSP00000368391; ENSG00000076554 [P55327-1]
ENST00000448733; ENSP00000410222; ENSG00000076554 [P55327-5]
ENST00000517427; ENSP00000429351; ENSG00000076554 [P55327-7]
ENST00000517462; ENSP00000429708; ENSG00000076554 [P55327-8]
ENST00000518937; ENSP00000429915; ENSG00000076554 [P55327-4]
ENST00000520527; ENSP00000429309; ENSG00000076554 [P55327-6]
GeneIDi7163
KEGGihsa:7163
UCSCiuc003ybr.3 human [P55327-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7163
DisGeNETi7163
EuPathDBiHostDB:ENSG00000076554.15

GeneCards: human genes, protein and diseases

More...GeneCardsi		TPD52

H-Invitational Database, human transcriptome db

More...H-InvDBi		HIX0152680
HGNCiHGNC:12005 TPD52
HPAiHPA028427
HPA062167
MIMi604068 gene
neXtProtiNX_P55327
OpenTargetsiENSG00000076554
PharmGKBiPA36686

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4010 Eukaryota
ENOG4111M9H LUCA
GeneTreeiENSGT00940000155294
HOGENOMiHOG000231968
HOVERGENiHBG058643
InParanoidiP55327
OMAiMDFYEDY
OrthoDBi1225782at2759
PhylomeDBiP55327
TreeFamiTF317562

Enzyme and pathway databases

ReactomeiR-HSA-432722 Golgi Associated Vesicle Biogenesis
SIGNORiP55327

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TPD52 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TPD52

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7163

Protein Ontology

More...PROi		PR:P55327

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000076554 Expressed in 232 organ(s), highest expression level in frontal cortex
ExpressionAtlasiP55327 baseline and differential
GenevisibleiP55327 HS

Family and domain databases

InterProiView protein in InterPro
IPR007327 TPD52
PANTHERiPTHR19307 PTHR19307, 1 hit
PfamiView protein in Pfam
PF04201 TPD52, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTPD52_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P55327
Secondary accession number(s): B7Z414
, C9J502, D0UFD1, D0UFD2, D0UFD3, D0UFD4, D0UFD5, E5RKB4, Q13056, Q53EK8, Q6FGP3, Q6FGS3, Q86YZ2, Q9UCX8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: November 25, 2008
Last modified: April 10, 2019
This is version 165 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again