Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cadherin-13

Gene

CDH13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. May act as a negative regulator of neural cell growth.1 Publication

GO - Molecular functioni

  • adiponectin binding Source: BHF-UCL
  • cadherin binding Source: BHF-UCL
  • calcium ion binding Source: GO_Central
  • cytoskeletal protein binding Source: GO_Central
  • lipoprotein particle binding Source: UniProtKB
  • low-density lipoprotein particle binding Source: BHF-UCL
  • protein homodimerization activity Source: GO_Central

GO - Biological processi

Keywordsi

Biological processCell adhesion
LigandCalcium, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-418990 Adherens junctions interactions
SIGNORiP55290

Names & Taxonomyi

Protein namesi
Recommended name:
Cadherin-13
Alternative name(s):
Heart cadherin
Short name:
H-cadherin
P105
Truncated cadherin
Short name:
T-cad
Short name:
T-cadherin
Gene namesi
Name:CDH13
Synonyms:CDHH
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000140945.15
HGNCiHGNC:1753 CDH13
MIMi601364 gene
neXtProtiNX_P55290

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi1012
OpenTargetsiENSG00000140945
PharmGKBiPA26287

Polymorphism and mutation databases

BioMutaiCDH13
DMDMi1705552

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Sequence analysisAdd BLAST22
PropeptideiPRO_000000379323 – 138Add BLAST116
ChainiPRO_0000003794139 – 693Cadherin-13Add BLAST555
PropeptideiPRO_0000003795694 – 713Removed in mature formCuratedAdd BLAST20

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi52N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi86N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi382N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi500N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi530N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi598N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi638N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi671N-linked (GlcNAc...) asparagineSequence analysis1
Lipidationi693GPI-anchor amidated glycineSequence analysis1

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

EPDiP55290
MaxQBiP55290
PaxDbiP55290
PeptideAtlasiP55290
PRIDEiP55290
ProteomicsDBi56840
56841 [P55290-2]
56842 [P55290-3]
TopDownProteomicsiP55290-1 [P55290-1]

PTM databases

iPTMnetiP55290
PhosphoSitePlusiP55290
SwissPalmiP55290

Expressioni

Tissue specificityi

Highly expressed in heart. In the CNS, expressed in cerebral cortex, medulla, hippocampus, amygdala, thalamus and substantia nigra. No expression detected in cerebellum or spinal cord.2 Publications

Developmental stagei

Expressed at higher levels in adult brain than in developing brain.1 Publication

Gene expression databases

BgeeiENSG00000140945 Expressed in 107 organ(s), highest expression level in descending thoracic aorta
CleanExiHS_CDH13
ExpressionAtlasiP55290 baseline and differential

Organism-specific databases

HPAiCAB025863
HPA001380

Interactioni

Subunit structurei

By contrast to classical cadherins, homodimerization in trans is not mediated by cadherin EC1 domain strand-swapping, but instead through a homophilic adhesive interface which joins two elongated EC1-EC2 domains through a region near their Ca2+-binding sites to form a tetrahedral, X-like shape.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107447, 31 interactors
IntActiP55290, 10 interactors
MINTiP55290
STRINGi9606.ENSP00000408632

Structurei

Secondary structure

1713
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP55290
SMRiP55290
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP55290

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini139 – 245Cadherin 1PROSITE-ProRule annotationAdd BLAST107
Domaini246 – 363Cadherin 2PROSITE-ProRule annotationAdd BLAST118
Domaini364 – 477Cadherin 3PROSITE-ProRule annotationAdd BLAST114
Domaini478 – 585Cadherin 4PROSITE-ProRule annotationAdd BLAST108
Domaini584 – 694Cadherin 5PROSITE-ProRule annotationAdd BLAST111

Domaini

Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.By similarity

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

GeneTreeiENSGT00760000118906
HOGENOMiHOG000169079
HOVERGENiHBG106438
InParanoidiP55290
KOiK06808
OMAiKANYHLP
OrthoDBiEOG091G02OG
PhylomeDBiP55290

Family and domain databases

InterProiView protein in InterPro
IPR039808 Cadherin
IPR002126 Cadherin-like_dom
IPR015919 Cadherin-like_sf
IPR020894 Cadherin_CS
IPR014868 Cadherin_pro_dom
IPR033216 CDH13
PANTHERiPTHR24027 PTHR24027, 1 hit
PTHR24027:SF80 PTHR24027:SF80, 1 hit
PfamiView protein in Pfam
PF00028 Cadherin, 5 hits
PF08758 Cadherin_pro, 1 hit
PRINTSiPR00205 CADHERIN
SMARTiView protein in SMART
SM00112 CA, 5 hits
SM01055 Cadherin_pro, 1 hit
SUPFAMiSSF49313 SSF49313, 6 hits
PROSITEiView protein in PROSITE
PS00232 CADHERIN_1, 3 hits
PS50268 CADHERIN_2, 5 hits

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P55290-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQPRTPLVLC VLLSQVLLLT SAEDLDCTPG FQQKVFHINQ PAEFIEDQSI
60 70 80 90 100
LNLTFSDCKG NDKLRYEVSS PYFKVNSDGG LVALRNITAV GKTLFVHART
110 120 130 140 150
PHAEDMAELV IVGGKDIQGS LQDIFKFART SPVPRQKRSI VVSPILIPEN
160 170 180 190 200
QRQPFPRDVG KVVDSDRPER SKFRLTGKGV DQEPKGIFRI NENTGSVSVT
210 220 230 240 250
RTLDREVIAV YQLFVETTDV NGKTLEGPVP LEVIVIDQND NRPIFREGPY
260 270 280 290 300
IGHVMEGSPT GTTVMRMTAF DADDPATDNA LLRYNIRQQT PDKPSPNMFY
310 320 330 340 350
IDPEKGDIVT VVSPALLDRE TLENPKYELI IEAQDMAGLD VGLTGTATAT
360 370 380 390 400
IMIDDKNDHS PKFTKKEFQA TVEEGAVGVI VNLTVEDKDD PTTGAWRAAY
410 420 430 440 450
TIINGNPGQS FEIHTNPQTN EGMLSVVKPL DYEISAFHTL LIKVENEDPL
460 470 480 490 500
VPDVSYGPSS TATVHITVLD VNEGPVFYPD PMMVTRQEDL SVGSVLLTVN
510 520 530 540 550
ATDPDSLQHQ TIRYSVYKDP AGWLNINPIN GTVDTTAVLD RESPFVDNSV
560 570 580 590 600
YTALFLAIDS GNPPATGTGT LLITLEDVND NAPFIYPTVA EVCDDAKNLS
610 620 630 640 650
VVILGASDKD LHPNTDPFKF EIHKQAVPDK VWKISKINNT HALVSLLQNL
660 670 680 690 700
NKANYNLPIM VTDSGKPPMT NITDLRVQVC SCRNSKVDCN AAGALRFSLP
710
SVLLLSLFSL ACL
Length:713
Mass (Da):78,287
Last modified:October 1, 1996 - v1
Checksum:iCEB662D77824CB60
GO
Isoform 2 (identifier: P55290-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-190: VVDSDRPERSKFRLTGKGVDQEPKGIFRI → RTHNPINSELLLNEGITADLNPCITILAI
     191-713: Missing.

Show »
Length:190
Mass (Da):21,058
Checksum:iC7DA89A2C0C036E9
GO
Isoform 3 (identifier: P55290-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-175: VVDSDRPERSKFRL → MKIWQVLCLARWLT
     176-713: Missing.

Show »
Length:175
Mass (Da):19,660
Checksum:i0038FABE744ECAE0
GO
Isoform 4 (identifier: P55290-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MQPRTPLVLCVLLS → MKTPPGASSRTKCSRELRSFCAFSCPRAKQPTCTAWFPQQEHPSENGPQMPGRDPPAASTM

Note: Gene prediction based on EST data.
Show »
Length:760
Mass (Da):83,397
Checksum:iB4BB30012F3D4560
GO
Isoform 5 (identifier: P55290-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-161: Missing.

Note: No experimental confirmation available.
Show »
Length:674
Mass (Da):73,787
Checksum:i4C15F7C62AE5B0AA
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BV21H3BV21_HUMAN
Cadherin-13
CDH13
56Annotation score:
F5H7W7F5H7W7_HUMAN
Cadherin-13
CDH13
52Annotation score:
H3BRL7H3BRL7_HUMAN
Cadherin-13
CDH13
67Annotation score:
H3BQH4H3BQH4_HUMAN
Cadherin-13
CDH13
67Annotation score:
H3BTF2H3BTF2_HUMAN
Cadherin-13
CDH13
37Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti199V → M in AAH28624 (Ref. 4) Curated1
Sequence conflicti199V → M in AAH30653 (Ref. 4) Curated1
Sequence conflicti288Q → R in AAH28624 (Ref. 4) Curated1
Sequence conflicti288Q → R in AAH30653 (Ref. 4) Curated1
Sequence conflicti392T → A in AAH28624 (Ref. 4) Curated1
Sequence conflicti392T → A in AAH30653 (Ref. 4) Curated1
Sequence conflicti544P → T in AAH28624 (Ref. 4) Curated1
Sequence conflicti544P → T in AAH30653 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06574765R → C in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant dbSNP:rs368685803Ensembl.1
Natural variantiVAR_065748103A → V in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant dbSNP:rs199539898Ensembl.1
Natural variantiVAR_065749113G → R in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant dbSNP:rs183971768Ensembl.1
Natural variantiVAR_030632121L → S. Corresponds to variant dbSNP:rs7197352Ensembl.1
Natural variantiVAR_065750246R → W in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant dbSNP:rs377210458Ensembl.1
Natural variantiVAR_065751367E → Q in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant dbSNP:rs200000145Ensembl.1
Natural variantiVAR_065752376A → T1 PublicationCorresponds to variant dbSNP:rs35549391Ensembl.1
Natural variantiVAR_065753643L → R1 PublicationCorresponds to variant dbSNP:rs34106627Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0467141 – 14MQPRT…CVLLS → MKTPPGASSRTKCSRELRSF CAFSCPRAKQPTCTAWFPQQ EHPSENGPQMPGRDPPAAST M in isoform 4. CuratedAdd BLAST14
Alternative sequenceiVSP_053739123 – 161Missing in isoform 5. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_042696162 – 190VVDSD…GIFRI → RTHNPINSELLLNEGITADL NPCITILAI in isoform 2. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_042794162 – 175VVDSD…SKFRL → MKIWQVLCLARWLT in isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_042795176 – 713Missing in isoform 3. 1 PublicationAdd BLAST538
Alternative sequenceiVSP_042697191 – 713Missing in isoform 2. 1 PublicationAdd BLAST523

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L34058 mRNA Translation: AAA35624.1
U59289 mRNA Translation: AAB18912.1
U59288 mRNA Translation: AAB18911.1
AB001103 Genomic DNA Translation: BAA32411.1
EU190357 mRNA Translation: ABW97440.1
EU190358 mRNA Translation: ABW97441.1
AK298612 mRNA Translation: BAH12826.1
AC009028 Genomic DNA No translation available.
AC009063 Genomic DNA No translation available.
AC009119 Genomic DNA No translation available.
AC009142 Genomic DNA No translation available.
AC087189 Genomic DNA No translation available.
AC092340 Genomic DNA No translation available.
AC092351 Genomic DNA No translation available.
AC098804 Genomic DNA No translation available.
AC099506 Genomic DNA No translation available.
AC106814 Genomic DNA No translation available.
AC125793 Genomic DNA No translation available.
BC028624 mRNA Translation: AAH28624.1
BC030653 mRNA Translation: AAH30653.1
CCDSiCCDS56009.1 [P55290-3]
CCDS56010.1 [P55290-2]
CCDS58485.1 [P55290-4]
CCDS58486.1 [P55290-1]
CCDS58487.1 [P55290-5]
PIRiB38992
RefSeqiNP_001207418.1, NM_001220489.1 [P55290-5]
NP_001207420.1, NM_001220491.1 [P55290-2]
NP_001207421.1, NM_001220492.1 [P55290-3]
NP_001248.1, NM_001257.4 [P55290-1]
UniGeneiHs.654386
Hs.661776

Genome annotation databases

EnsembliENST00000268613; ENSP00000268613; ENSG00000140945 [P55290-4]
ENST00000428848; ENSP00000394557; ENSG00000140945 [P55290-5]
ENST00000431540; ENSP00000408632; ENSG00000140945 [P55290-2]
ENST00000565636; ENSP00000456491; ENSG00000140945 [P55290-3]
ENST00000567109; ENSP00000479395; ENSG00000140945 [P55290-1]
GeneIDi1012
KEGGihsa:1012
UCSCiuc002fgx.4 human [P55290-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L34058 mRNA Translation: AAA35624.1
U59289 mRNA Translation: AAB18912.1
U59288 mRNA Translation: AAB18911.1
AB001103 Genomic DNA Translation: BAA32411.1
EU190357 mRNA Translation: ABW97440.1
EU190358 mRNA Translation: ABW97441.1
AK298612 mRNA Translation: BAH12826.1
AC009028 Genomic DNA No translation available.
AC009063 Genomic DNA No translation available.
AC009119 Genomic DNA No translation available.
AC009142 Genomic DNA No translation available.
AC087189 Genomic DNA No translation available.
AC092340 Genomic DNA No translation available.
AC092351 Genomic DNA No translation available.
AC098804 Genomic DNA No translation available.
AC099506 Genomic DNA No translation available.
AC106814 Genomic DNA No translation available.
AC125793 Genomic DNA No translation available.
BC028624 mRNA Translation: AAH28624.1
BC030653 mRNA Translation: AAH30653.1
CCDSiCCDS56009.1 [P55290-3]
CCDS56010.1 [P55290-2]
CCDS58485.1 [P55290-4]
CCDS58486.1 [P55290-1]
CCDS58487.1 [P55290-5]
PIRiB38992
RefSeqiNP_001207418.1, NM_001220489.1 [P55290-5]
NP_001207420.1, NM_001220491.1 [P55290-2]
NP_001207421.1, NM_001220492.1 [P55290-3]
NP_001248.1, NM_001257.4 [P55290-1]
UniGeneiHs.654386
Hs.661776

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2V37NMR-A139-243[»]
ProteinModelPortaliP55290
SMRiP55290
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107447, 31 interactors
IntActiP55290, 10 interactors
MINTiP55290
STRINGi9606.ENSP00000408632

PTM databases

iPTMnetiP55290
PhosphoSitePlusiP55290
SwissPalmiP55290

Polymorphism and mutation databases

BioMutaiCDH13
DMDMi1705552

Proteomic databases

EPDiP55290
MaxQBiP55290
PaxDbiP55290
PeptideAtlasiP55290
PRIDEiP55290
ProteomicsDBi56840
56841 [P55290-2]
56842 [P55290-3]
TopDownProteomicsiP55290-1 [P55290-1]

Protocols and materials databases

DNASUi1012
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000268613; ENSP00000268613; ENSG00000140945 [P55290-4]
ENST00000428848; ENSP00000394557; ENSG00000140945 [P55290-5]
ENST00000431540; ENSP00000408632; ENSG00000140945 [P55290-2]
ENST00000565636; ENSP00000456491; ENSG00000140945 [P55290-3]
ENST00000567109; ENSP00000479395; ENSG00000140945 [P55290-1]
GeneIDi1012
KEGGihsa:1012
UCSCiuc002fgx.4 human [P55290-1]

Organism-specific databases

CTDi1012
DisGeNETi1012
EuPathDBiHostDB:ENSG00000140945.15
GeneCardsiCDH13
HGNCiHGNC:1753 CDH13
HPAiCAB025863
HPA001380
MIMi601364 gene
neXtProtiNX_P55290
OpenTargetsiENSG00000140945
PharmGKBiPA26287
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00760000118906
HOGENOMiHOG000169079
HOVERGENiHBG106438
InParanoidiP55290
KOiK06808
OMAiKANYHLP
OrthoDBiEOG091G02OG
PhylomeDBiP55290

Enzyme and pathway databases

ReactomeiR-HSA-418990 Adherens junctions interactions
SIGNORiP55290

Miscellaneous databases

ChiTaRSiCDH13 human
EvolutionaryTraceiP55290
GeneWikiiT-cadherin
GenomeRNAii1012
PROiPR:P55290
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000140945 Expressed in 107 organ(s), highest expression level in descending thoracic aorta
CleanExiHS_CDH13
ExpressionAtlasiP55290 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR039808 Cadherin
IPR002126 Cadherin-like_dom
IPR015919 Cadherin-like_sf
IPR020894 Cadherin_CS
IPR014868 Cadherin_pro_dom
IPR033216 CDH13
PANTHERiPTHR24027 PTHR24027, 1 hit
PTHR24027:SF80 PTHR24027:SF80, 1 hit
PfamiView protein in Pfam
PF00028 Cadherin, 5 hits
PF08758 Cadherin_pro, 1 hit
PRINTSiPR00205 CADHERIN
SMARTiView protein in SMART
SM00112 CA, 5 hits
SM01055 Cadherin_pro, 1 hit
SUPFAMiSSF49313 SSF49313, 6 hits
PROSITEiView protein in PROSITE
PS00232 CADHERIN_1, 3 hits
PS50268 CADHERIN_2, 5 hits
ProtoNetiSearch...

Entry informationi

Entry nameiCAD13_HUMAN
AccessioniPrimary (citable) accession number: P55290
Secondary accession number(s): A8W476
, A8W477, B7Z590, C9JRI6, J3KN62, Q6GTW4, Q8TBX3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: November 7, 2018
This is version 179 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again