Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 186 (18 Sep 2019)
Sequence version 1 (01 Oct 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cadherin-13

Gene

CDH13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. May act as a negative regulator of neural cell growth.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processCell adhesion
LigandCalcium, Metal-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-418990 Adherens junctions interactions

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P55290

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cadherin-13
Alternative name(s):
Heart cadherin
Short name:
H-cadherin
P105
Truncated cadherin
Short name:
T-cad
Short name:
T-cadherin
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CDH13
Synonyms:CDHH
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1753 CDH13

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601364 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P55290

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1012

Open Targets

More...
OpenTargetsi
ENSG00000140945

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26287

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P55290

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CDH13

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1705552

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 22Sequence analysisAdd BLAST22
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_000000379323 – 138Add BLAST116
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000003794139 – 693Cadherin-13Add BLAST555
PropeptideiPRO_0000003795694 – 713Removed in mature formCuratedAdd BLAST20

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi52N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi86N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi382N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi500N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi530N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi598N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi638N-linked (GlcNAc...) asparagine2 Publications1
Glycosylationi671N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi693GPI-anchor amidated glycineSequence analysis1

Keywords - PTMi

Cleavage on pair of basic residues, Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-656
non-CPTAC-2636

Encyclopedia of Proteome Dynamics

More...
EPDi
P55290

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P55290

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P55290

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P55290

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P55290

PeptideAtlas

More...
PeptideAtlasi
P55290

PRoteomics IDEntifications database

More...
PRIDEi
P55290

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
56840 [P55290-1]
56841 [P55290-2]
56842 [P55290-3]
6668

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P55290-1 [P55290-1]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1921

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P55290

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P55290

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P55290

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in heart. In the CNS, expressed in cerebral cortex, medulla, hippocampus, amygdala, thalamus and substantia nigra. No expression detected in cerebellum or spinal cord.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed at higher levels in adult brain than in developing brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000140945 Expressed in 107 organ(s), highest expression level in descending thoracic aorta

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P55290 baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB025863
HPA001380

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

By contrast to classical cadherins, homodimerization in trans is not mediated by cadherin EC1 domain strand-swapping, but instead through a homophilic adhesive interface which joins two elongated EC1-EC2 domains through a region near their Ca2+-binding sites to form a tetrahedral, X-like shape.

By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107447, 32 interactors

Protein interaction database and analysis system

More...
IntActi
P55290, 30 interactors

Molecular INTeraction database

More...
MINTi
P55290

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000268613

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1713
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P55290

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P55290

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini139 – 245Cadherin 1PROSITE-ProRule annotationAdd BLAST107
Domaini246 – 363Cadherin 2PROSITE-ProRule annotationAdd BLAST118
Domaini364 – 477Cadherin 3PROSITE-ProRule annotationAdd BLAST114
Domaini478 – 585Cadherin 4PROSITE-ProRule annotationAdd BLAST108
Domaini584 – 694Cadherin 5PROSITE-ProRule annotationAdd BLAST111

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Three calcium ions are usually bound at the interface of each cadherin domain and rigidify the connections, imparting a strong curvature to the full-length ectodomain.By similarity

Keywords - Domaini

Repeat, Signal

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155218

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000169079

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P55290

KEGG Orthology (KO)

More...
KOi
K06808

Identification of Orthologs from Complete Genome Data

More...
OMAi
TIATYQL

Database of Orthologous Groups

More...
OrthoDBi
215774at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P55290

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039808 Cadherin
IPR002126 Cadherin-like_dom
IPR015919 Cadherin-like_sf
IPR020894 Cadherin_CS
IPR014868 Cadherin_pro_dom
IPR033216 CDH13

The PANTHER Classification System

More...
PANTHERi
PTHR24027 PTHR24027, 1 hit
PTHR24027:SF80 PTHR24027:SF80, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00028 Cadherin, 5 hits
PF08758 Cadherin_pro, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00205 CADHERIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00112 CA, 5 hits
SM01055 Cadherin_pro, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49313 SSF49313, 6 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00232 CADHERIN_1, 3 hits
PS50268 CADHERIN_2, 5 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P55290-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQPRTPLVLC VLLSQVLLLT SAEDLDCTPG FQQKVFHINQ PAEFIEDQSI
60 70 80 90 100
LNLTFSDCKG NDKLRYEVSS PYFKVNSDGG LVALRNITAV GKTLFVHART
110 120 130 140 150
PHAEDMAELV IVGGKDIQGS LQDIFKFART SPVPRQKRSI VVSPILIPEN
160 170 180 190 200
QRQPFPRDVG KVVDSDRPER SKFRLTGKGV DQEPKGIFRI NENTGSVSVT
210 220 230 240 250
RTLDREVIAV YQLFVETTDV NGKTLEGPVP LEVIVIDQND NRPIFREGPY
260 270 280 290 300
IGHVMEGSPT GTTVMRMTAF DADDPATDNA LLRYNIRQQT PDKPSPNMFY
310 320 330 340 350
IDPEKGDIVT VVSPALLDRE TLENPKYELI IEAQDMAGLD VGLTGTATAT
360 370 380 390 400
IMIDDKNDHS PKFTKKEFQA TVEEGAVGVI VNLTVEDKDD PTTGAWRAAY
410 420 430 440 450
TIINGNPGQS FEIHTNPQTN EGMLSVVKPL DYEISAFHTL LIKVENEDPL
460 470 480 490 500
VPDVSYGPSS TATVHITVLD VNEGPVFYPD PMMVTRQEDL SVGSVLLTVN
510 520 530 540 550
ATDPDSLQHQ TIRYSVYKDP AGWLNINPIN GTVDTTAVLD RESPFVDNSV
560 570 580 590 600
YTALFLAIDS GNPPATGTGT LLITLEDVND NAPFIYPTVA EVCDDAKNLS
610 620 630 640 650
VVILGASDKD LHPNTDPFKF EIHKQAVPDK VWKISKINNT HALVSLLQNL
660 670 680 690 700
NKANYNLPIM VTDSGKPPMT NITDLRVQVC SCRNSKVDCN AAGALRFSLP
710
SVLLLSLFSL ACL
Length:713
Mass (Da):78,287
Last modified:October 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCEB662D77824CB60
GO
Isoform 2 (identifier: P55290-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-190: VVDSDRPERSKFRLTGKGVDQEPKGIFRI → RTHNPINSELLLNEGITADLNPCITILAI
     191-713: Missing.

Show »
Length:190
Mass (Da):21,058
Checksum:iC7DA89A2C0C036E9
GO
Isoform 3 (identifier: P55290-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     162-175: VVDSDRPERSKFRL → MKIWQVLCLARWLT
     176-713: Missing.

Show »
Length:175
Mass (Da):19,660
Checksum:i0038FABE744ECAE0
GO
Isoform 4 (identifier: P55290-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MQPRTPLVLCVLLS → MKTPPGASSRTKCSRELRSFCAFSCPRAKQPTCTAWFPQQEHPSENGPQMPGRDPPAASTM

Note: Gene prediction based on EST data.
Show »
Length:760
Mass (Da):83,397
Checksum:iB4BB30012F3D4560
GO
Isoform 5 (identifier: P55290-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-161: Missing.

Note: No experimental confirmation available.
Show »
Length:674
Mass (Da):73,787
Checksum:i4C15F7C62AE5B0AA
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H7W7F5H7W7_HUMAN
Cadherin-13
CDH13
52Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BRL7H3BRL7_HUMAN
Cadherin-13
CDH13
67Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BV21H3BV21_HUMAN
Cadherin-13
CDH13
56Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BQH4H3BQH4_HUMAN
Cadherin-13
CDH13
67Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BTF2H3BTF2_HUMAN
Cadherin-13
CDH13
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti199V → M in AAH28624 (Ref. 4) Curated1
Sequence conflicti199V → M in AAH30653 (Ref. 4) Curated1
Sequence conflicti288Q → R in AAH28624 (Ref. 4) Curated1
Sequence conflicti288Q → R in AAH30653 (Ref. 4) Curated1
Sequence conflicti392T → A in AAH28624 (Ref. 4) Curated1
Sequence conflicti392T → A in AAH30653 (Ref. 4) Curated1
Sequence conflicti544P → T in AAH28624 (Ref. 4) Curated1
Sequence conflicti544P → T in AAH30653 (Ref. 4) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06574765R → C in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant dbSNP:rs368685803Ensembl.1
Natural variantiVAR_065748103A → V in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant dbSNP:rs199539898Ensembl.1
Natural variantiVAR_065749113G → R in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant dbSNP:rs183971768Ensembl.1
Natural variantiVAR_030632121L → S. Corresponds to variant dbSNP:rs7197352Ensembl.1
Natural variantiVAR_065750246R → W in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant dbSNP:rs377210458Ensembl.1
Natural variantiVAR_065751367E → Q in a patient with amyotrophic lateral sclerosis. 1 PublicationCorresponds to variant dbSNP:rs200000145Ensembl.1
Natural variantiVAR_065752376A → T1 PublicationCorresponds to variant dbSNP:rs35549391EnsemblClinVar.1
Natural variantiVAR_065753643L → R1 PublicationCorresponds to variant dbSNP:rs34106627Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0467141 – 14MQPRT…CVLLS → MKTPPGASSRTKCSRELRSF CAFSCPRAKQPTCTAWFPQQ EHPSENGPQMPGRDPPAAST M in isoform 4. CuratedAdd BLAST14
Alternative sequenceiVSP_053739123 – 161Missing in isoform 5. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_042696162 – 190VVDSD…GIFRI → RTHNPINSELLLNEGITADL NPCITILAI in isoform 2. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_042794162 – 175VVDSD…SKFRL → MKIWQVLCLARWLT in isoform 3. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_042795176 – 713Missing in isoform 3. 1 PublicationAdd BLAST538
Alternative sequenceiVSP_042697191 – 713Missing in isoform 2. 1 PublicationAdd BLAST523

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L34058 mRNA Translation: AAA35624.1
U59289 mRNA Translation: AAB18912.1
U59288 mRNA Translation: AAB18911.1
AB001103 Genomic DNA Translation: BAA32411.1
EU190357 mRNA Translation: ABW97440.1
EU190358 mRNA Translation: ABW97441.1
AK298612 mRNA Translation: BAH12826.1
AC009028 Genomic DNA No translation available.
AC009063 Genomic DNA No translation available.
AC009119 Genomic DNA No translation available.
AC009142 Genomic DNA No translation available.
AC087189 Genomic DNA No translation available.
AC092340 Genomic DNA No translation available.
AC092351 Genomic DNA No translation available.
AC098804 Genomic DNA No translation available.
AC099506 Genomic DNA No translation available.
AC106814 Genomic DNA No translation available.
AC125793 Genomic DNA No translation available.
BC028624 mRNA Translation: AAH28624.1
BC030653 mRNA Translation: AAH30653.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS56009.1 [P55290-3]
CCDS56010.1 [P55290-2]
CCDS58485.1 [P55290-4]
CCDS58486.1 [P55290-1]
CCDS58487.1 [P55290-5]

Protein sequence database of the Protein Information Resource

More...
PIRi
B38992

NCBI Reference Sequences

More...
RefSeqi
NP_001207418.1, NM_001220489.1 [P55290-5]
NP_001207420.1, NM_001220491.1 [P55290-2]
NP_001207421.1, NM_001220492.1 [P55290-3]
NP_001248.1, NM_001257.4 [P55290-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000268613; ENSP00000268613; ENSG00000140945 [P55290-4]
ENST00000428848; ENSP00000394557; ENSG00000140945 [P55290-5]
ENST00000431540; ENSP00000408632; ENSG00000140945 [P55290-2]
ENST00000565636; ENSP00000456491; ENSG00000140945 [P55290-3]
ENST00000567109; ENSP00000479395; ENSG00000140945 [P55290-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1012

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1012

UCSC genome browser

More...
UCSCi
uc002fgx.4 human [P55290-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L34058 mRNA Translation: AAA35624.1
U59289 mRNA Translation: AAB18912.1
U59288 mRNA Translation: AAB18911.1
AB001103 Genomic DNA Translation: BAA32411.1
EU190357 mRNA Translation: ABW97440.1
EU190358 mRNA Translation: ABW97441.1
AK298612 mRNA Translation: BAH12826.1
AC009028 Genomic DNA No translation available.
AC009063 Genomic DNA No translation available.
AC009119 Genomic DNA No translation available.
AC009142 Genomic DNA No translation available.
AC087189 Genomic DNA No translation available.
AC092340 Genomic DNA No translation available.
AC092351 Genomic DNA No translation available.
AC098804 Genomic DNA No translation available.
AC099506 Genomic DNA No translation available.
AC106814 Genomic DNA No translation available.
AC125793 Genomic DNA No translation available.
BC028624 mRNA Translation: AAH28624.1
BC030653 mRNA Translation: AAH30653.1
CCDSiCCDS56009.1 [P55290-3]
CCDS56010.1 [P55290-2]
CCDS58485.1 [P55290-4]
CCDS58486.1 [P55290-1]
CCDS58487.1 [P55290-5]
PIRiB38992
RefSeqiNP_001207418.1, NM_001220489.1 [P55290-5]
NP_001207420.1, NM_001220491.1 [P55290-2]
NP_001207421.1, NM_001220492.1 [P55290-3]
NP_001248.1, NM_001257.4 [P55290-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2V37NMR-A139-243[»]
SMRiP55290
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi107447, 32 interactors
IntActiP55290, 30 interactors
MINTiP55290
STRINGi9606.ENSP00000268613

PTM databases

GlyConnecti1921
iPTMnetiP55290
PhosphoSitePlusiP55290
SwissPalmiP55290

Polymorphism and mutation databases

BioMutaiCDH13
DMDMi1705552

Proteomic databases

CPTACiCPTAC-656
non-CPTAC-2636
EPDiP55290
jPOSTiP55290
MassIVEiP55290
MaxQBiP55290
PaxDbiP55290
PeptideAtlasiP55290
PRIDEiP55290
ProteomicsDBi56840 [P55290-1]
56841 [P55290-2]
56842 [P55290-3]
6668
TopDownProteomicsiP55290-1 [P55290-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
1012

Genome annotation databases

EnsembliENST00000268613; ENSP00000268613; ENSG00000140945 [P55290-4]
ENST00000428848; ENSP00000394557; ENSG00000140945 [P55290-5]
ENST00000431540; ENSP00000408632; ENSG00000140945 [P55290-2]
ENST00000565636; ENSP00000456491; ENSG00000140945 [P55290-3]
ENST00000567109; ENSP00000479395; ENSG00000140945 [P55290-1]
GeneIDi1012
KEGGihsa:1012
UCSCiuc002fgx.4 human [P55290-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1012
DisGeNETi1012

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CDH13
HGNCiHGNC:1753 CDH13
HPAiCAB025863
HPA001380
MIMi601364 gene
neXtProtiNX_P55290
OpenTargetsiENSG00000140945
PharmGKBiPA26287

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000155218
HOGENOMiHOG000169079
InParanoidiP55290
KOiK06808
OMAiTIATYQL
OrthoDBi215774at2759
PhylomeDBiP55290

Enzyme and pathway databases

ReactomeiR-HSA-418990 Adherens junctions interactions
SIGNORiP55290

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CDH13 human
EvolutionaryTraceiP55290

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
T-cadherin

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1012
PharosiP55290

Protein Ontology

More...
PROi
PR:P55290

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000140945 Expressed in 107 organ(s), highest expression level in descending thoracic aorta
ExpressionAtlasiP55290 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR039808 Cadherin
IPR002126 Cadherin-like_dom
IPR015919 Cadherin-like_sf
IPR020894 Cadherin_CS
IPR014868 Cadherin_pro_dom
IPR033216 CDH13
PANTHERiPTHR24027 PTHR24027, 1 hit
PTHR24027:SF80 PTHR24027:SF80, 1 hit
PfamiView protein in Pfam
PF00028 Cadherin, 5 hits
PF08758 Cadherin_pro, 1 hit
PRINTSiPR00205 CADHERIN
SMARTiView protein in SMART
SM00112 CA, 5 hits
SM01055 Cadherin_pro, 1 hit
SUPFAMiSSF49313 SSF49313, 6 hits
PROSITEiView protein in PROSITE
PS00232 CADHERIN_1, 3 hits
PS50268 CADHERIN_2, 5 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCAD13_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P55290
Secondary accession number(s): A8W476
, A8W477, B7Z590, C9JRI6, J3KN62, Q6GTW4, Q8TBX3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: September 18, 2019
This is version 186 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again