Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P55265 (DSRAD_HUMAN)

Entry version 211 (26 Feb 2020)
Sequence version 4 (30 Nov 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Double-stranded RNA-specific adenosine deaminase

Gene

ADAR

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the hydrolytic deamination of adenosine to inosine in double-stranded RNA (dsRNA) referred to as A-to-I RNA editing (PubMed:7972084, PubMed:7565688, PubMed:12618436). This may affect gene expression and function in a number of ways that include mRNA translation by changing codons and hence the amino acid sequence of proteins; pre-mRNA splicing by altering splice site recognition sequences; RNA stability by changing sequences involved in nuclease recognition; genetic stability in the case of RNA virus genomes by changing sequences during viral RNA replication; and RNA structure-dependent activities such as microRNA production or targeting or protein-RNA interactions. Can edit both viral and cellular RNAs and can edit RNAs at multiple sites (hyper-editing) or at specific sites (site-specific editing). Its cellular RNA substrates include: bladder cancer-associated protein (BLCAP), neurotransmitter receptors for glutamate (GRIA2) and serotonin (HTR2C) and GABA receptor (GABRA3). Site-specific RNA editing of transcripts encoding these proteins results in amino acid substitutions which consequently alters their functional activities. Exhibits low-level editing at the GRIA2 Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Its viral RNA substrates include: hepatitis C virus (HCV), vesicular stomatitis virus (VSV), measles virus (MV), hepatitis delta virus (HDV), and human immunodeficiency virus type 1 (HIV-1). Exhibits either a proviral (HDV, MV, VSV and HIV-1) or an antiviral effect (HCV) and this can be editing-dependent (HDV and HCV), editing-independent (VSV and MV) or both (HIV-1). Impairs HCV replication via RNA editing at multiple sites. Enhances the replication of MV, VSV and HIV-1 through an editing-independent mechanism via suppression of EIF2AK2/PKR activation and function. Stimulates both the release and infectivity of HIV-1 viral particles by an editing-dependent mechanism where it associates with viral RNAs and edits adenosines in the 5'UTR and the Rev and Tat coding sequence. Can enhance viral replication of HDV via A-to-I editing at a site designated as amber/W, thereby changing an UAG amber stop codon to an UIG tryptophan (W) codon that permits synthesis of the large delta antigen (L-HDAg) which has a key role in the assembly of viral particles. However, high levels of ADAR1 inhibit HDV replication.14 Publications

Caution

The N-terminus of isoform 4 has been derived from EST and genomic sequences.Curated

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi910ZincPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei912Proton donorPROSITE-ProRule annotation1
Metal bindingi966ZincPROSITE-ProRule annotation1
Metal bindingi1036ZincPROSITE-ProRule annotation1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Hydrolase, RNA-binding
Biological processAntiviral defense, Immunity, Innate immunity, mRNA processing, RNA-mediated gene silencing
LigandMetal-binding, Zinc

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.5.4.37 2681

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-75102 C6 deamination of adenosine
R-HSA-77042 Formation of editosomes by ADAR proteins
R-HSA-909733 Interferon alpha/beta signaling

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Double-stranded RNA-specific adenosine deaminase (EC:3.5.4.372 Publications)
Short name:
DRADA1 Publication
Alternative name(s):
136 kDa double-stranded RNA-binding protein
Short name:
p136
Interferon-inducible protein 4
Short name:
IFI-4
K88DSRBP
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADAR
Synonyms:ADAR1, DSRAD, G1P1, IFI4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:225 ADAR

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		146920 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P55265

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Dyschromatosis symmetrica hereditaria (DSH)3 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant pigmentary genodermatosis characterized by a mixture of hyperpigmented and hypopigmented macules distributed on the face and the dorsal parts of the hands and feet, that appear in infancy or early childhood.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_017604923L → P in DSH. 1 PublicationCorresponds to variant dbSNP:rs28936680EnsemblClinVar.1
Natural variantiVAR_021729966C → F in DSH. 1 Publication1
Natural variantiVAR_0266691155R → W in DSH. 1 PublicationCorresponds to variant dbSNP:rs1044845711Ensembl.1
Natural variantiVAR_0176051165F → S in DSH. 1 PublicationCorresponds to variant dbSNP:rs28936681EnsemblClinVar.1
Aicardi-Goutieres syndrome 6 (AGS6)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of Aicardi-Goutieres syndrome, a genetically heterogeneous disease characterized by cerebral atrophy, leukoencephalopathy, intracranial calcifications, chronic cerebrospinal fluid (CSF) lymphocytosis, increased CSF alpha-interferon, and negative serologic investigations for common prenatal infection. Clinical features as thrombocytopenia, hepatosplenomegaly and elevated hepatic transaminases along with intermittent fever may erroneously suggest an infective process. Severe neurological dysfunctions manifest in infancy as progressive microcephaly, spasticity, dystonic posturing and profound psychomotor retardation. Death often occurs in early childhood.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_069535193P → A in AGS6. 1 PublicationCorresponds to variant dbSNP:rs145588689EnsemblClinVar.1
Natural variantiVAR_069536870A → T in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122893EnsemblClinVar.1
Natural variantiVAR_069537872I → T in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122897EnsemblClinVar.1
Natural variantiVAR_069538892R → H in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122892EnsemblClinVar.1
Natural variantiVAR_069539999K → N in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122896EnsemblClinVar.1
Natural variantiVAR_0695401007G → R in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122822EnsemblClinVar.1
Natural variantiVAR_0695411112Y → F in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122895EnsemblClinVar.1
Natural variantiVAR_0695421113D → H in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122894EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi418K → R: Abolishes sumoylation. 1 Publication1
Mutagenesisi708 – 801Missing : Abolishes nuclear location. 1 PublicationAdd BLAST94
Mutagenesisi708 – 710MMP → AMA: Decreased nuclear and partially cytoplasmic location. 1 Publication3
Mutagenesisi712 – 715KVRK → AVAA: No effect on nuclear location. No effect on RNA binding. 1 Publication4
Mutagenesisi716 – 724Missing : Disrupts the bi-partite nuclear localization signal and abolishes nuclear location. 1 Publication9
Mutagenesisi716I → N: Disrupts the bi-partite nuclear localization signal and abolishes nuclear location; when associated with S-719 and N-723. 1 Publication1
Mutagenesisi718E → A: No effect on nuclear location; when associated with A-721 and A-724. 1 Publication1
Mutagenesisi719L → S: Disrupts the bi-partite nuclear localization signal and abolishes nuclear location; when associated with N-716 and N-723. 1 Publication1
Mutagenesisi721R → A: No effect on nuclear location; when associated with A-721 and A-724. 1 Publication1
Mutagenesisi723L → N: Disrupts the bi-partite nuclear localization signal and abolishes nuclear location; when associated with N-716 and S-719. 1 Publication1
Mutagenesisi724N → A: No effect on nuclear location; when associated with A-718 and A-721. 1 Publication1
Mutagenesisi725 – 801Missing : Disrupts nuclear localization signal. No effect on RNA binding. 1 PublicationAdd BLAST77
Mutagenesisi777 – 778KK → AA: Strongly impaired RNA binding. No effect on nuclear location. 1 Publication2
Mutagenesisi801R → A: Abolishes interaction with TNPO1, TNPO1-mediated nuclear import and nuclear location. 1 Publication1

Keywords - Diseasei

Aicardi-Goutieres syndrome, Disease mutation

Organism-specific databases

DisGeNET

More...DisGeNETi		103

GeneReviews a resource of expert-authored, peer-reviewed disease descriptions.

More...GeneReviewsi		ADAR

MalaCards human disease database

More...MalaCardsi		ADAR
MIMi127400 phenotype
615010 phenotype

Open Targets

More...OpenTargetsi		ENSG00000160710

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		51 Aicardi-Goutieres syndrome
41 Dyschromatosis symmetrica hereditaria
225154 Familial infantile bilateral striatal necrosis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA24555

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P55265 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ADAR

Domain mapping of disease mutations (DMDM)

More...DMDMi		313104303

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001717741 – 1226Double-stranded RNA-specific adenosine deaminaseAdd BLAST1226

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei26Asymmetric dimethylarginineCombined sources1
Modified residuei285PhosphoserineBy similarity1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki384Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki408Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki418Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate
Cross-linki418Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki418Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei481PhosphoserineCombined sources1
Cross-linki580Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei601PhosphothreonineCombined sources1
Modified residuei603PhosphothreonineCombined sources1
Modified residuei614PhosphoserineCombined sources1
Modified residuei629PhosphoserineCombined sources1
Modified residuei636PhosphoserineCombined sources1
Modified residuei808PhosphothreonineCombined sources1
Modified residuei814PhosphoserineCombined sources1
Modified residuei823PhosphoserineCombined sources1
Modified residuei825PhosphoserineCombined sources1
Cross-linki875Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Sumoylation reduces RNA-editing activity.1 Publication

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P55265

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P55265

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P55265

MaxQB - The MaxQuant DataBase

More...MaxQBi		P55265

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P55265

PeptideAtlas

More...PeptideAtlasi		P55265

PRoteomics IDEntifications database

More...PRIDEi		P55265

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		56826 [P55265-1]
56827 [P55265-2]
56828 [P55265-3]
56829 [P55265-4]
56830 [P55265-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P55265

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P55265

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P55265

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed, highest levels were found in brain and lung (PubMed:7972084). Isoform 5 is expressed at higher levels in astrocytomas as compared to normal brain tissue and expression increases strikingly with the severity of the tumor, being higher in the most aggressive tumors.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Isoform 1 is induced by interferon alpha. Isoform 5 is constitutively expressed.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000160710 Expressed in testis and 236 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P55265 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P55265 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB056157
HPA003890
HPA051519

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer. Homodimerization is essential for its catalytic activity (PubMed:12618436). Isoform 5 can form heterodimers with ADARB1/ADAR2.

Isoform 1 interacts with ILF2/NF45 and ILF3/NF90 (PubMed:16055709). Binding to ILF3/NF90 up-regulates ILF3-mediated gene expression. Isoform 1 and isoform 5 (via DRBM 3 domain) interact with TNPO1 (PubMed:19124606, PubMed:24753571). Isoform 5 (via DRBM domains) interacts with XPO5 (PubMed:19124606). Isoform 1 and isoform 5 can interact with EIF2AK2/PKR and UPF1 (PubMed:17079286, PubMed:18362360).

10 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		106617, 87 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		P55265

Database of interacting proteins

More...DIPi		DIP-29310N

Protein interaction database and analysis system

More...IntActi		P55265, 58 interactors

Molecular INTeraction database

More...MINTi		P55265

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000357459

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P55265 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11226
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P55265

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P55265

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati133 – 202DRADA 1PROSITE-ProRule annotation3 PublicationsAdd BLAST70
Repeati293 – 360DRADA 2PROSITE-ProRule annotationAdd BLAST68
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini503 – 571DRBM 1PROSITE-ProRule annotationAdd BLAST69
Domaini614 – 682DRBM 2PROSITE-ProRule annotationAdd BLAST69
Domaini726 – 794DRBM 3PROSITE-ProRule annotation1 PublicationAdd BLAST69
Domaini886 – 1221A to I editasePROSITE-ProRule annotationAdd BLAST336

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni133 – 202Interaction with Z-DNA3 PublicationsAdd BLAST70
Regioni716 – 725N-terminal extension of DRBM 3 and constituent of a bi-partite nuclear localization signal1 Publication10
Regioni795 – 801C-terminal extension of DRBM 3 and constituent of a bi-partite nuclear localization signal1 Publication7

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The first DRADA repeat binds Z-DNA.3 Publications
The third dsRNA-binding domain (DRBM 3) contains an additional N-terminal alpha-helix that is part of a bi-partite nuclear localization signal, together with the sequence immediately C-terminal to DRBM 3. The presence of DRBM 3 is important to bring together the N-terminal and the C-terminal part of the bi-partite nuclear localization signal for import mediated by TNPO1 (PubMed:24753571). RNA binding interferes with nuclear import (PubMed:19124606, PubMed:24753571).2 Publications

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2777 Eukaryota
ENOG410XT0Z LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000157243

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_005382_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P55265

KEGG Orthology (KO)

More...KOi		K12968

Identification of Orthologs from Complete Genome Data

More...OMAi		KRERMQM

Database of Orthologous Groups

More...OrthoDBi		686369at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P55265

TreeFam database of animal gene trees

More...TreeFami		TF315806

Family and domain databases

Conserved Domains Database

More...CDDi		cd00048 DSRM, 3 hits

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.10.10.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR002466 A_deamin
IPR014720 dsRBD_dom
IPR000607 dsRNA_A_deaminase_rpt
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
IPR042371 Zalpha_dom

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02137 A_deamin, 1 hit
PF00035 dsrm, 3 hits
PF02295 z-alpha, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00552 ADEAMc, 1 hit
SM00358 DSRM, 3 hits
SM00550 Zalpha, 2 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF46785 SSF46785, 2 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50141 A_DEAMIN_EDITASE, 1 hit
PS50139 DRADA_REPEAT, 2 hits
PS50137 DS_RBD, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative promoter usage and alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P55265-1) [UniParc]FASTAAdd to basket
Also known as: ADAR-a, ADAR1L, p150

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNPRQGYSLS GYYTHPFQGY EHRQLRYQQP GPGSSPSSFL LKQIEFLKGQ 
        60         70         80         90        100
LPEAPVIGKQ TPSLPPSLPG LRPRFPVLLA SSTRGRQVDI RGVPRGVHLR 
       110        120        130        140        150
SQGLQRGFQH PSPRGRSLPQ RGVDCLSSHF QELSIYQDQE QRILKFLEEL 
       160        170        180        190        200
GEGKATTAHD LSGKLGTPKK EINRVLYSLA KKGKLQKEAG TPPLWKIAVS 
       210        220        230        240        250
TQAWNQHSGV VRPDGHSQGA PNSDPSLEPE DRNSTSVSED LLEPFIAVSA 
       260        270        280        290        300
QAWNQHSGVV RPDSHSQGSP NSDPGLEPED SNSTSALEDP LEFLDMAEIK 
       310        320        330        340        350
EKICDYLFNV SDSSALNLAK NIGLTKARDI NAVLIDMERQ GDVYRQGTTP 
       360        370        380        390        400
PIWHLTDKKR ERMQIKRNTN SVPETAPAAI PETKRNAEFL TCNIPTSNAS 
       410        420        430        440        450
NNMVTTEKVE NGQEPVIKLE NRQEARPEPA RLKPPVHYNG PSKAGYVDFE 
       460        470        480        490        500
NGQWATDDIP DDLNSIRAAP GEFRAIMEMP SFYSHGLPRC SPYKKLTECQ 
       510        520        530        540        550
LKNPISGLLE YAQFASQTCE FNMIEQSGPP HEPRFKFQVV INGREFPPAE 
       560        570        580        590        600
AGSKKVAKQD AAMKAMTILL EEAKAKDSGK SEESSHYSTE KESEKTAESQ 
       610        620        630        640        650
TPTPSATSFF SGKSPVTTLL ECMHKLGNSC EFRLLSKEGP AHEPKFQYCV 
       660        670        680        690        700
AVGAQTFPSV SAPSKKVAKQ MAAEEAMKAL HGEATNSMAS DNQPEGMISE 
       710        720        730        740        750
SLDNLESMMP NKVRKIGELV RYLNTNPVGG LLEYARSHGF AAEFKLVDQS 
       760        770        780        790        800
GPPHEPKFVY QAKVGGRWFP AVCAHSKKQG KQEAADAALR VLIGENEKAE 
       810        820        830        840        850
RMGFTEVTPV TGASLRRTML LLSRSPEAQP KTLPLTGSTF HDQIAMLSHR 
       860        870        880        890        900
CFNTLTNSFQ PSLLGRKILA AIIMKKDSED MGVVVSLGTG NRCVKGDSLS 
       910        920        930        940        950
LKGETVNDCH AEIISRRGFI RFLYSELMKY NSQTAKDSIF EPAKGGEKLQ 
       960        970        980        990       1000
IKKTVSFHLY ISTAPCGDGA LFDKSCSDRA MESTESRHYP VFENPKQGKL 
      1010       1020       1030       1040       1050
RTKVENGEGT IPVESSDIVP TWDGIRLGER LRTMSCSDKI LRWNVLGLQG 
      1060       1070       1080       1090       1100
ALLTHFLQPI YLKSVTLGYL FSQGHLTRAI CCRVTRDGSA FEDGLRHPFI 
      1110       1120       1130       1140       1150
VNHPKVGRVS IYDSKRQSGK TKETSVNWCL ADGYDLEILD GTRGTVDGPR 
      1160       1170       1180       1190       1200
NELSRVSKKN IFLLFKKLCS FRYRRDLLRL SYGEAKKAAR DYETAKNYFK 
      1210       1220 
KGLKDMGYGN WISKPQEEKN FYLCPV
Note: Produced by alternative promoter usage.
Length:1,226
Mass (Da):136,066
Last modified:November 30, 2010 - v4
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9CE095D6F9C1BC79
GO
Isoform 2 (identifier: P55265-2) [UniParc]FASTAAdd to basket
Also known as: ADAR-b

The sequence of this isoform differs from the canonical sequence as follows:
     807-832: Missing.

Note: Produced by alternative splicing of isoform 1.Curated
Show »
Length:1,200
Mass (Da):133,274
Checksum:i4CB1B306DAC584FC
GO
Isoform 3 (identifier: P55265-3) [UniParc]FASTAAdd to basket
Also known as: ADAR-c

The sequence of this isoform differs from the canonical sequence as follows:
     694-712: Missing.
     807-832: Missing.

Note: Produced by alternative splicing of isoform 1.Curated
Show »
Length:1,181
Mass (Da):131,170
Checksum:i9764C8AB27BE118E
GO
Isoform 4 (identifier: P55265-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-5: MNPRQ → MMSPICDQTIDSRLKVEKATWWGRVGGGSRPHWQPPGVRPCPEEVQDP

Note: Produced by alternative splicing of isoform 1.Curated
Show »
Length:1,269
Mass (Da):140,838
Checksum:iBB9B1DF19B8D3BC8
GO
Isoform 5 (identifier: P55265-5) [UniParc]FASTAAdd to basket
Also known as: ADAR1S, p110

The sequence of this isoform differs from the canonical sequence as follows:
     1-295: Missing.

Note: Produced by alternative promoter usage.Curated
Show »
Length:931
Mass (Da):103,642
Checksum:i113B63CF165097FC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A3B3IRQ9A0A3B3IRQ9_HUMAN
Double-stranded RNA-specific adenos...
ADAR
1,158Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ISX1A0A3B3ISX1_HUMAN
Double-stranded RNA-specific adenos...
ADAR
707Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ITG9A0A3B3ITG9_HUMAN
Double-stranded RNA-specific adenos...
ADAR
350Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3B3ISU1A0A3B3ISU1_HUMAN
Double-stranded RNA-specific adenos...
ADAR
164Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAE45853 differs from that shown. Reason: Erroneous termination. Extended C-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti53E → G in CAA55968 (Ref. 4) Curated1
Sequence conflicti245F → L in CAE45853 (PubMed:17974005).Curated1
Sequence conflicti482F → L in CAE45853 (PubMed:17974005).Curated1
Sequence conflicti873I → V in CAE45853 (PubMed:17974005).Curated1
Sequence conflicti1093D → G in CAE45853 (PubMed:17974005).Curated1
Sequence conflicti1184E → K in CAA55967 (Ref. 4) Curated1
Sequence conflicti1184E → K in CAA55968 (Ref. 4) Curated1
Sequence conflicti1184E → K in CAA67169 (Ref. 4) Curated1
Sequence conflicti1184E → K in CAA67170 (Ref. 4) Curated1
Isoform 4 (identifier: P55265-4)
Sequence conflicti13R → G in CAE45853 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048725100R → G6 PublicationsCorresponds to variant dbSNP:rs1466731EnsemblClinVar.1
Natural variantiVAR_069535193P → A in AGS6. 1 PublicationCorresponds to variant dbSNP:rs145588689EnsemblClinVar.1
Natural variantiVAR_017240384K → R4 PublicationsCorresponds to variant dbSNP:rs2229857EnsemblClinVar.1
Natural variantiVAR_024407587Y → C. Corresponds to variant dbSNP:rs17843865EnsemblClinVar.1
Natural variantiVAR_035805806E → V in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs144119808Ensembl.1
Natural variantiVAR_069536870A → T in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122893EnsemblClinVar.1
Natural variantiVAR_069537872I → T in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122897EnsemblClinVar.1
Natural variantiVAR_069538892R → H in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122892EnsemblClinVar.1
Natural variantiVAR_017604923L → P in DSH. 1 PublicationCorresponds to variant dbSNP:rs28936680EnsemblClinVar.1
Natural variantiVAR_021729966C → F in DSH. 1 Publication1
Natural variantiVAR_069539999K → N in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122896EnsemblClinVar.1
Natural variantiVAR_0695401007G → R in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122822EnsemblClinVar.1
Natural variantiVAR_0695411112Y → F in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122895EnsemblClinVar.1
Natural variantiVAR_0695421113D → H in AGS6. 1 PublicationCorresponds to variant dbSNP:rs398122894EnsemblClinVar.1
Natural variantiVAR_0266691155R → W in DSH. 1 PublicationCorresponds to variant dbSNP:rs1044845711Ensembl.1
Natural variantiVAR_0176051165F → S in DSH. 1 PublicationCorresponds to variant dbSNP:rs28936681EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0192351 – 295Missing in isoform 5. 1 PublicationAdd BLAST295
Alternative sequenceiVSP_0088721 – 5MNPRQ → MMSPICDQTIDSRLKVEKAT WWGRVGGGSRPHWQPPGVRP CPEEVQDP in isoform 4. 1 Publication5
Alternative sequenceiVSP_008873694 – 712Missing in isoform 3. CuratedAdd BLAST19
Alternative sequenceiVSP_008874807 – 832Missing in isoform 2 and isoform 3. CuratedAdd BLAST26

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U10439 mRNA Translation: AAB06697.1
U75503 U75502 Genomic DNA Translation: AAB97116.1
U75503 U75502 Genomic DNA Translation: AAB97117.1
U75503 U75502 Genomic DNA Translation: AAB97118.1
U18121 mRNA Translation: AAC13782.1
X79448 mRNA Translation: CAA55967.1
X79449 mRNA Translation: CAA55968.1
X98559 mRNA Translation: CAA67169.1
X98559 mRNA Translation: CAA67170.1
BX538232 mRNA Translation: CAD98075.1
BX640741 mRNA Translation: CAE45853.1 Sequence problems.
AL592078 Genomic DNA No translation available.
AL606500 Genomic DNA No translation available.
AL691488 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53183.1
CH471121 Genomic DNA Translation: EAW53187.1
BC038227 mRNA Translation: AAH38227.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS1071.1 [P55265-1]
CCDS30879.1 [P55265-5]

Protein sequence database of the Protein Information Resource

More...PIRi		S65593

NCBI Reference Sequences

More...RefSeqi		NP_001020278.1, NM_001025107.2 [P55265-5]
NP_001102.2, NM_001111.4 [P55265-1]
NP_001180424.1, NM_001193495.1 [P55265-5]
NP_056655.2, NM_015840.3 [P55265-2]
NP_056656.2, NM_015841.3 [P55265-3]
XP_006711174.1, XM_006711111.3
XP_006711175.1, XM_006711112.2
XP_006711176.1, XM_006711113.2 [P55265-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000368474; ENSP00000357459; ENSG00000160710 [P55265-1]
ENST00000368471; ENSP00000357456; ENSG00000160710 [P55265-5]
ENST00000529168; ENSP00000431794; ENSG00000160710 [P55265-2]
ENST00000648231; ENSP00000497555; ENSG00000160710 [P55265-5]
ENST00000648311; ENSP00000498137; ENSG00000160710 [P55265-5]
ENST00000649042; ENSP00000497790; ENSG00000160710 [P55265-5]
ENST00000649724; ENSP00000497932; ENSG00000160710 [P55265-5]
ENST00000649749; ENSP00000497210; ENSG00000160710 [P55265-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		103

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:103

UCSC genome browser

More...UCSCi		uc001ffh.4 human [P55265-1]

Keywords - Coding sequence diversityi

Alternative promoter usage, Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U10439 mRNA Translation: AAB06697.1
U75503 U75502 Genomic DNA Translation: AAB97116.1
U75503 U75502 Genomic DNA Translation: AAB97117.1
U75503 U75502 Genomic DNA Translation: AAB97118.1
U18121 mRNA Translation: AAC13782.1
X79448 mRNA Translation: CAA55967.1
X79449 mRNA Translation: CAA55968.1
X98559 mRNA Translation: CAA67169.1
X98559 mRNA Translation: CAA67170.1
BX538232 mRNA Translation: CAD98075.1
BX640741 mRNA Translation: CAE45853.1 Sequence problems.
AL592078 Genomic DNA No translation available.
AL606500 Genomic DNA No translation available.
AL691488 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW53183.1
CH471121 Genomic DNA Translation: EAW53187.1
BC038227 mRNA Translation: AAH38227.1
CCDSiCCDS1071.1 [P55265-1]
CCDS30879.1 [P55265-5]
PIRiS65593
RefSeqiNP_001020278.1, NM_001025107.2 [P55265-5]
NP_001102.2, NM_001111.4 [P55265-1]
NP_001180424.1, NM_001193495.1 [P55265-5]
NP_056655.2, NM_015840.3 [P55265-2]
NP_056656.2, NM_015841.3 [P55265-3]
XP_006711174.1, XM_006711111.3
XP_006711175.1, XM_006711112.2
XP_006711176.1, XM_006711113.2 [P55265-5]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1QBJX-ray2.10A/B/C133-209[»]
1QGPNMR-A125-200[»]
1XMKX-ray0.97A294-366[»]
2ACJX-ray2.60A/B/C/D140-202[»]
2GXBX-ray2.25A/B140-202[»]
2L54NMR-A136-198[»]
2MDRNMR-A708-801[»]
3F21X-ray2.20A/B/C133-209[»]
3F22X-ray2.50A/B/C133-209[»]
3F23X-ray2.70A/B/C133-209[»]
3IRQX-ray2.80A/B/C/D140-202[»]
3IRRX-ray2.65A/B/C/D140-202[»]
5ZU1X-ray3.01A/B/C/D140-198[»]
5ZUOX-ray2.90A/B/C/D140-202[»]
5ZUPX-ray2.90A/B/C/D140-202[»]
SMRiP55265
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi106617, 87 interactors
CORUMiP55265
DIPiDIP-29310N
IntActiP55265, 58 interactors
MINTiP55265
STRINGi9606.ENSP00000357459

PTM databases

iPTMnetiP55265
PhosphoSitePlusiP55265
SwissPalmiP55265

Polymorphism and mutation databases

BioMutaiADAR
DMDMi313104303

Proteomic databases

EPDiP55265
jPOSTiP55265
MassIVEiP55265
MaxQBiP55265
PaxDbiP55265
PeptideAtlasiP55265
PRIDEiP55265
ProteomicsDBi56826 [P55265-1]
56827 [P55265-2]
56828 [P55265-3]
56829 [P55265-4]
56830 [P55265-5]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		103

Genome annotation databases

EnsembliENST00000368474; ENSP00000357459; ENSG00000160710 [P55265-1]
ENST00000368471; ENSP00000357456; ENSG00000160710 [P55265-5]
ENST00000529168; ENSP00000431794; ENSG00000160710 [P55265-2]
ENST00000648231; ENSP00000497555; ENSG00000160710 [P55265-5]
ENST00000648311; ENSP00000498137; ENSG00000160710 [P55265-5]
ENST00000649042; ENSP00000497790; ENSG00000160710 [P55265-5]
ENST00000649724; ENSP00000497932; ENSG00000160710 [P55265-5]
ENST00000649749; ENSP00000497210; ENSG00000160710 [P55265-5]
GeneIDi103
KEGGihsa:103
UCSCiuc001ffh.4 human [P55265-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		103
DisGeNETi103

GeneCards: human genes, protein and diseases

More...GeneCardsi		ADAR
GeneReviewsiADAR
HGNCiHGNC:225 ADAR
HPAiCAB056157
HPA003890
HPA051519
MalaCardsiADAR
MIMi127400 phenotype
146920 gene
615010 phenotype
neXtProtiNX_P55265
OpenTargetsiENSG00000160710
Orphaneti51 Aicardi-Goutieres syndrome
41 Dyschromatosis symmetrica hereditaria
225154 Familial infantile bilateral striatal necrosis
PharmGKBiPA24555

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2777 Eukaryota
ENOG410XT0Z LUCA
GeneTreeiENSGT00940000157243
HOGENOMiCLU_005382_0_0_1
InParanoidiP55265
KOiK12968
OMAiKRERMQM
OrthoDBi686369at2759
PhylomeDBiP55265
TreeFamiTF315806

Enzyme and pathway databases

BRENDAi3.5.4.37 2681
ReactomeiR-HSA-75102 C6 deamination of adenosine
R-HSA-77042 Formation of editosomes by ADAR proteins
R-HSA-909733 Interferon alpha/beta signaling

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ADAR human
EvolutionaryTraceiP55265

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ADAR

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		103
PharosiP55265 Tbio

Protein Ontology

More...PROi		PR:P55265
RNActiP55265 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000160710 Expressed in testis and 236 other tissues
ExpressionAtlasiP55265 baseline and differential
GenevisibleiP55265 HS

Family and domain databases

CDDicd00048 DSRM, 3 hits
Gene3Di1.10.10.10, 2 hits
InterProiView protein in InterPro
IPR002466 A_deamin
IPR014720 dsRBD_dom
IPR000607 dsRNA_A_deaminase_rpt
IPR036388 WH-like_DNA-bd_sf
IPR036390 WH_DNA-bd_sf
IPR042371 Zalpha_dom
PfamiView protein in Pfam
PF02137 A_deamin, 1 hit
PF00035 dsrm, 3 hits
PF02295 z-alpha, 2 hits
SMARTiView protein in SMART
SM00552 ADEAMc, 1 hit
SM00358 DSRM, 3 hits
SM00550 Zalpha, 2 hits
SUPFAMiSSF46785 SSF46785, 2 hits
PROSITEiView protein in PROSITE
PS50141 A_DEAMIN_EDITASE, 1 hit
PS50139 DRADA_REPEAT, 2 hits
PS50137 DS_RBD, 3 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDSRAD_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P55265
Secondary accession number(s): B1AQQ9
, B1AQR0, D3DV76, O15223, O43859, O43860, Q9BYM3, Q9BYM4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: November 30, 2010
Last modified: February 26, 2020
This is version 211 of the entry and version 4 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again