Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P55263 (ADK_HUMAN)

Entry version 210 (29 Sep 2021)
Sequence version 2 (30 May 2000)
Previous versions | rss
Add a publicationFeedback
Protein

Adenosine kinase

Gene

ADK

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

ATP dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives. Serves as a potential regulator of concentrations of extracellular adenosine and intracellular adenine nucleotides.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+Note: Binds 3 Mg2+ ions per subunit.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: AMP biosynthesis via salvage pathway

This protein is involved in step 1 of the subpathway that synthesizes AMP from adenosine. This subpathway is part of the pathway AMP biosynthesis via salvage pathway, which is itself part of Purine metabolism.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes AMP from adenosine, the pathway AMP biosynthesis via salvage pathway and in Purine metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi49Magnesium 11
Metal bindingi147Magnesium 21
Metal bindingi148Magnesium 21
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei3171

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Transferase
Biological processPurine salvage
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:HS08097-MONOMER

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		2.7.1.20, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P55263

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-74217, Purine salvage

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		P55263

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...UniPathwayi		UPA00588;UER00659

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Adenosine kinase (EC:2.7.1.20)
Short name:
AK
Alternative name(s):
Adenosine 5'-phosphotransferase
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADK
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:257, ADK

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		102750, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P55263

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000156110

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Hypermethioninemia due to adenosine kinase deficiency (HMAKD)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA metabolic disorder characterized by global developmental delay, early-onset seizures, mild dysmorphic features, and characteristic biochemical anomalies, including persistent hypermethioninemia with increased levels of S-adenosylmethionine and S-adenosylhomocysteine. Homocysteine levels are typically normal.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_06664030G → E in HMAKD; the mutant shows some residual activity. 1 PublicationCorresponds to variant dbSNP:rs397514454EnsemblClinVar.1
Natural variantiVAR_066641235D → A in HMAKD; the mutant shows some residual activity. 1 PublicationCorresponds to variant dbSNP:rs397514453EnsemblClinVar.1
Natural variantiVAR_066642318A → E in HMAKD; complete loss of activity. 1 PublicationCorresponds to variant dbSNP:rs397514452EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi11 – 12KK → AA or AD: Abolishes nuclear localization. 1 Publication2

Keywords - Diseasei

Disease variant

Organism-specific databases

DisGeNET

More...DisGeNETi		132

MalaCards human disease database

More...MalaCardsi		ADK
MIMi614300, phenotype

Open Targets

More...OpenTargetsi		ENSG00000156110

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		289290, Hypermethioninemia encephalopathy due to adenosine kinase deficiency

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA24579

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P55263, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3589

Drug and drug target database

More...DrugBanki		DB07280, 5-[4-(DIMETHYLAMINO)PHENYL]-6-[(6-MORPHOLIN-4-YLPYRIDIN-3-YL)ETHYNYL]PYRIMIDIN-4-AMINE
DB07173, 7-(5-DEOXY-BETA-D-RIBOFURANOSYL)-5-IODO-7H-PYRROLO[2,3-D]PYRIMIDIN-4-AMINE
DB01048, Abacavir
DB00640, Adenosine
DB00131, Adenosine phosphate
DB00171, ATP
DB00811, Ribavirin

DrugCentral

More...DrugCentrali		P55263

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		1231

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ADK

Domain mapping of disease mutations (DMDM)

More...DMDMi		6840802

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000800532 – 362Adenosine kinaseAdd BLAST361

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei77Phosphotyrosine1 Publication1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...CPTACi		CPTAC-162

Encyclopedia of Proteome Dynamics

More...EPDi		P55263

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P55263

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P55263

MaxQB - The MaxQuant DataBase

More...MaxQBi		P55263

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P55263

PeptideAtlas

More...PeptideAtlasi		P55263

PRoteomics IDEntifications database

More...PRIDEi		P55263

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		56823 [P55263-1]
56824 [P55263-2]
56825 [P55263-3]
6910

2D gel databases

REPRODUCTION-2DPAGE

More...REPRODUCTION-2DPAGEi		IPI00234368

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P55263, 1 site, 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P55263

MetOSite database of methionine sulfoxide sites

More...MetOSitei		P55263

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P55263

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P55263

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Highest level in placenta, liver, muscle and kidney.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000156110, Expressed in cartilage tissue and 236 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P55263, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P55263, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000156110, Tissue enhanced (liver)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer.

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		106644, 23 interactors

Protein interaction database and analysis system

More...IntActi		P55263, 6 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000286621

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P55263

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P55263, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1362
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P55263

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P55263

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi8 – 16Nuclear localization signal1 Publication9

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the carbohydrate kinase PfkB family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG2854, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000014320

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_045832_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P55263

Identification of Orthologs from Complete Genome Data

More...OMAi		APFIAQF

Database of Orthologous Groups

More...OrthoDBi		1226324at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P55263

TreeFam database of animal gene trees

More...TreeFami		TF300745

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		3.40.1190.20, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001805, Adenokinase
IPR002173, Carboh/pur_kinase_PfkB_CS
IPR011611, PfkB_dom
IPR029056, Ribokinase-like

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00294, PfkB, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00989, ADENOKINASE

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF53613, SSF53613, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00584, PFKB_KINASES_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P55263-1) [UniParc]FASTAAdd to basket
Also known as: Long

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAEEEPKP KKLKVEAPQA LRENILFGMG NPLLDISAVV DKDFLDKYSL 
        60         70         80         90        100
KPNDQILAED KHKELFDELV KKFKVEYHAG GSTQNSIKVA QWMIQQPHKA 
       110        120        130        140        150
ATFFGCIGID KFGEILKRKA AEAHVDAHYY EQNEQPTGTC AACITGDNRS 
       160        170        180        190        200
LIANLAAANC YKKEKHLDLE KNWMLVEKAR VCYIAGFFLT VSPESVLKVA 
       210        220        230        240        250
HHASENNRIF TLNLSAPFIS QFYKESLMKV MPYVDILFGN ETEAATFARE 
       260        270        280        290        300
QGFETKDIKE IAKKTQALPK MNSKRQRIVI FTQGRDDTIM ATESEVTAFA 
       310        320        330        340        350
VLDQDQKEII DTNGAGDAFV GGFLSQLVSD KPLTECIRAG HYAASIIIRR 
       360 
TGCTFPEKPD FH
Length:362
Mass (Da):40,545
Last modified:May 30, 2000 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i48AA4925865BFE70
GO
Isoform 2 (identifier: P55263-2) [UniParc]FASTAAdd to basket
Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-21: MAAAEEEPKPKKLKVEAPQAL → MTSV

Show »
Length:345
Mass (Da):38,703
Checksum:i7DC20F364E63D944
GO
Isoform 3 (identifier: P55263-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     186-242: Missing.

Show »
Length:305
Mass (Da):34,084
Checksum:iDC7E0245659B0F06
GO
Isoform 4 (identifier: P55263-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-65: MAAAEEEPKP...ILAEDKHKEL → MTSVRENILFGMGNPLLDISAVVDKDFLDK

Show »
Length:327
Mass (Da):36,580
Checksum:iE5A9FDBDB77E7357
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A5F9ZHJ1A0A5F9ZHJ1_HUMAN
Adenosine kinase
ADK
270Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9ZH72A0A5F9ZH72_HUMAN
Adenosine kinase
ADK
229Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9ZH31A0A5F9ZH31_HUMAN
Adenosine kinase
ADK
294Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5K1VW54A0A5K1VW54_HUMAN
Adenosine kinase
ADK
347Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5K1VW94A0A5K1VW94_HUMAN
Adenosine kinase
ADK
356Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9ZGZ8A0A5F9ZGZ8_HUMAN
Adenosine kinase
ADK
179Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9ZH83A0A5F9ZH83_HUMAN
Adenosine kinase
ADK
99Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9ZH76A0A5F9ZH76_HUMAN
Adenosine kinase
ADK
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAB01689 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti98H → A AA sequence (PubMed:8577746).Curated1
Sequence conflicti133N → D in AAB01689 (PubMed:8917457).Curated1
Sequence conflicti171K → R in AAB01689 (PubMed:8917457).Curated1
Sequence conflicti190T → H in AAA97893 (PubMed:8577746).Curated1
Sequence conflicti219I → F in AAH03568 (PubMed:15489334).Curated1
Sequence conflicti273S → V AA sequence (PubMed:8577746).Curated1
Sequence conflicti289I → N AA sequence (PubMed:8577746).Curated1
Sequence conflicti307K → R in AAB01689 (PubMed:8917457).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06664030G → E in HMAKD; the mutant shows some residual activity. 1 PublicationCorresponds to variant dbSNP:rs397514454EnsemblClinVar.1
Natural variantiVAR_066641235D → A in HMAKD; the mutant shows some residual activity. 1 PublicationCorresponds to variant dbSNP:rs397514453EnsemblClinVar.1
Natural variantiVAR_066642318A → E in HMAKD; complete loss of activity. 1 PublicationCorresponds to variant dbSNP:rs397514452EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0046681 – 65MAAAE…KHKEL → MTSVRENILFGMGNPLLDIS AVVDKDFLDK in isoform 4. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_0467131 – 21MAAAE…APQAL → MTSV in isoform 2. 4 PublicationsAdd BLAST21
Alternative sequenceiVSP_043526186 – 242Missing in isoform 3. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U50196 mRNA Translation: AAA97893.1
U33936 mRNA Translation: AAB01689.1 Frameshift.
U90338 mRNA Translation: AAB50234.1
U90339 mRNA Translation: AAB50235.1
AK290633 mRNA Translation: BAF83322.1
AK301590 mRNA Translation: BAH13519.1
AK302706 mRNA Translation: BAH13786.1
AC012046 Genomic DNA No translation available.
AC022026 Genomic DNA No translation available.
AC022540 Genomic DNA No translation available.
AC091699 Genomic DNA No translation available.
AL357037 Genomic DNA No translation available.
AL731576 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54555.1
CH471083 Genomic DNA Translation: EAW54556.1
BC003568 mRNA Translation: AAH03568.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS55716.1 [P55263-3]
CCDS55717.1 [P55263-4]
CCDS7343.1 [P55263-1]
CCDS7344.1 [P55263-2]

Protein sequence database of the Protein Information Resource

More...PIRi		JC5363
JC5364

NCBI Reference Sequences

More...RefSeqi		NP_001114.2, NM_001123.3 [P55263-2]
NP_001189378.1, NM_001202449.1 [P55263-4]
NP_001189379.1, NM_001202450.1 [P55263-3]
NP_006712.2, NM_006721.3 [P55263-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000372734; ENSP00000361819; ENSG00000156110 [P55263-2]
ENST00000539909; ENSP00000443965; ENSG00000156110 [P55263-1]
ENST00000672429; ENSP00000500292; ENSG00000156110 [P55263-3]
ENST00000673027; ENSP00000500201; ENSG00000156110 [P55263-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		132

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:132

UCSC genome browser

More...UCSCi		uc001jwi.4, human [P55263-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U50196 mRNA Translation: AAA97893.1
U33936 mRNA Translation: AAB01689.1 Frameshift.
U90338 mRNA Translation: AAB50234.1
U90339 mRNA Translation: AAB50235.1
AK290633 mRNA Translation: BAF83322.1
AK301590 mRNA Translation: BAH13519.1
AK302706 mRNA Translation: BAH13786.1
AC012046 Genomic DNA No translation available.
AC022026 Genomic DNA No translation available.
AC022540 Genomic DNA No translation available.
AC091699 Genomic DNA No translation available.
AL357037 Genomic DNA No translation available.
AL731576 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54555.1
CH471083 Genomic DNA Translation: EAW54556.1
BC003568 mRNA Translation: AAH03568.1
CCDSiCCDS55716.1 [P55263-3]
CCDS55717.1 [P55263-4]
CCDS7343.1 [P55263-1]
CCDS7344.1 [P55263-2]
PIRiJC5363
JC5364
RefSeqiNP_001114.2, NM_001123.3 [P55263-2]
NP_001189378.1, NM_001202449.1 [P55263-4]
NP_001189379.1, NM_001202450.1 [P55263-3]
NP_006712.2, NM_006721.3 [P55263-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1BX4X-ray1.50A22-362[»]
2I6AX-ray2.20A/B/C/D22-362[»]
2I6BX-ray2.30A/B22-362[»]
4O1LX-ray2.50A/B17-362[»]
SMRiP55263
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi106644, 23 interactors
IntActiP55263, 6 interactors
STRINGi9606.ENSP00000286621

Chemistry databases

BindingDBiP55263
ChEMBLiCHEMBL3589
DrugBankiDB07280, 5-[4-(DIMETHYLAMINO)PHENYL]-6-[(6-MORPHOLIN-4-YLPYRIDIN-3-YL)ETHYNYL]PYRIMIDIN-4-AMINE
DB07173, 7-(5-DEOXY-BETA-D-RIBOFURANOSYL)-5-IODO-7H-PYRROLO[2,3-D]PYRIMIDIN-4-AMINE
DB01048, Abacavir
DB00640, Adenosine
DB00131, Adenosine phosphate
DB00171, ATP
DB00811, Ribavirin
DrugCentraliP55263
GuidetoPHARMACOLOGYi1231

PTM databases

GlyGeniP55263, 1 site, 1 O-linked glycan (1 site)
iPTMnetiP55263
MetOSiteiP55263
PhosphoSitePlusiP55263
SwissPalmiP55263

Genetic variation databases

BioMutaiADK
DMDMi6840802

2D gel databases

REPRODUCTION-2DPAGEiIPI00234368

Proteomic databases

CPTACiCPTAC-162
EPDiP55263
jPOSTiP55263
MassIVEiP55263
MaxQBiP55263
PaxDbiP55263
PeptideAtlasiP55263
PRIDEiP55263
ProteomicsDBi56823 [P55263-1]
56824 [P55263-2]
56825 [P55263-3]
6910

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		29612, 453 antibodies

The DNASU plasmid repository

More...DNASUi		132

Genome annotation databases

EnsembliENST00000372734; ENSP00000361819; ENSG00000156110 [P55263-2]
ENST00000539909; ENSP00000443965; ENSG00000156110 [P55263-1]
ENST00000672429; ENSP00000500292; ENSG00000156110 [P55263-3]
ENST00000673027; ENSP00000500201; ENSG00000156110 [P55263-4]
GeneIDi132
KEGGihsa:132
UCSCiuc001jwi.4, human [P55263-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		132
DisGeNETi132

GeneCards: human genes, protein and diseases

More...GeneCardsi		ADK
HGNCiHGNC:257, ADK
HPAiENSG00000156110, Tissue enhanced (liver)
MalaCardsiADK
MIMi102750, gene
614300, phenotype
neXtProtiNX_P55263
OpenTargetsiENSG00000156110
Orphaneti289290, Hypermethioninemia encephalopathy due to adenosine kinase deficiency
PharmGKBiPA24579
VEuPathDBiHostDB:ENSG00000156110

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG2854, Eukaryota
GeneTreeiENSGT00390000014320
HOGENOMiCLU_045832_0_0_1
InParanoidiP55263
OMAiAPFIAQF
OrthoDBi1226324at2759
PhylomeDBiP55263
TreeFamiTF300745

Enzyme and pathway databases

UniPathwayiUPA00588;UER00659
BioCyciMetaCyc:HS08097-MONOMER
BRENDAi2.7.1.20, 2681
PathwayCommonsiP55263
ReactomeiR-HSA-74217, Purine salvage
SABIO-RKiP55263

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		132, 7 hits in 1024 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ADK, human
EvolutionaryTraceiP55263

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		ADK_(gene)

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		132
PharosiP55263, Tchem

Protein Ontology

More...PROi		PR:P55263
RNActiP55263, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000156110, Expressed in cartilage tissue and 236 other tissues
ExpressionAtlasiP55263, baseline and differential
GenevisibleiP55263, HS

Family and domain databases

Gene3Di3.40.1190.20, 1 hit
InterProiView protein in InterPro
IPR001805, Adenokinase
IPR002173, Carboh/pur_kinase_PfkB_CS
IPR011611, PfkB_dom
IPR029056, Ribokinase-like
PfamiView protein in Pfam
PF00294, PfkB, 1 hit
PRINTSiPR00989, ADENOKINASE
SUPFAMiSSF53613, SSF53613, 1 hit
PROSITEiView protein in PROSITE
PS00584, PFKB_KINASES_2, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADK_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P55263
Secondary accession number(s): B7Z783
, B7Z800, O00741, O00742, Q16710, Q5JQ10, Q5JQ11, Q9BTN2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: May 30, 2000
Last modified: September 29, 2021
This is version 210 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again