Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Caspase-7

Gene

CASP7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Strict requirement for an Asp residue at position P1 and has a preferred cleavage sequence of Asp-Glu-Val-Asp-|-. EC:3.4.22.60

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Inhibited by isatin sulfonamides.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei144By similarity1
Active sitei1861

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • cysteine-type endopeptidase activity Source: Reactome
  • cysteine-type endopeptidase activity involved in apoptotic process Source: GO_Central
  • cysteine-type endopeptidase activity involved in execution phase of apoptosis Source: CAFA
  • cysteine-type peptidase activity Source: ProtInc
  • peptidase activity Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
Biological processApoptosis

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.4.22.60 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-111459 Activation of caspases through apoptosome-mediated cleavage
R-HSA-111463 SMAC binds to IAPs
R-HSA-111464 SMAC-mediated dissociation of IAP:caspase complexes
R-HSA-111465 Apoptotic cleavage of cellular proteins
R-HSA-264870 Caspase-mediated cleavage of cytoskeletal proteins

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P55210

Protein family/group databases

MEROPS protease database

More...
MEROPSi
C14.004

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Caspase-7 (EC:3.4.22.60)
Short name:
CASP-7
Alternative name(s):
Apoptotic protease Mch-3
CMH-1
ICE-like apoptotic protease 3
Short name:
ICE-LAP3
Cleaved into the following 2 chains:
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CASP7
Synonyms:MCH3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000165806.19

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1508 CASP7

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601761 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P55210

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi186C → A: No apoptotic activity. 1

Organism-specific databases

DisGeNET

More...
DisGeNETi
840

Open Targets

More...
OpenTargetsi
ENSG00000165806

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26091

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3468

Drug and drug target database

More...
DrugBanki
DB03384 Fica
DB05408 IDN-6556

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1623

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CASP7

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1730092

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_00000046162 – 23N-terminally processedAdd BLAST22
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000000461724 – 198Caspase-7 subunit p20Add BLAST175
PropeptideiPRO_0000004618199 – 2068
ChainiPRO_0000004619207 – 303Caspase-7 subunit p11Add BLAST97

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1
Modified residuei37PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Cleavages by granzyme B or caspase-10 generate the two active subunits. Propeptide domains can also be cleaved efficiently by caspase-3. Active heterodimers between the small subunit of caspase-7 and the large subunit of caspase-3, and vice versa, also occur.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Zymogen

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P55210

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P55210

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P55210

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P55210

PeptideAtlas

More...
PeptideAtlasi
P55210

PRoteomics IDEntifications database

More...
PRIDEi
P55210

ProteomicsDB human proteome resource

More...
ProteomicsDBi
56811
56812 [P55210-2]
56813 [P55210-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P55210

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P55210

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P55210

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000165806 Expressed in 211 organ(s), highest expression level in colonic mucosa

CleanEx database of gene expression profiles

More...
CleanExi
HS_CASP7

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P55210 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P55210 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB025563

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 20 kDa (p20) and a 11 kDa (p11) subunit. Interacts with BIRC6/bruce.2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107290, 47 interactors

Database of interacting proteins

More...
DIPi
DIP-29973N

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P55210

Protein interaction database and analysis system

More...
IntActi
P55210, 18 interactors

Molecular INTeraction database

More...
MINTi
P55210

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000358327

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P55210

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1303
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1F1JX-ray2.35A/B2-303[»]
1GQFX-ray2.90A/B47-303[»]
1I4OX-ray2.40A/B24-303[»]
1I51X-ray2.45A/C51-198[»]
B/D199-303[»]
1K86X-ray2.60A/B51-303[»]
1K88X-ray2.70A/B51-303[»]
1KMCX-ray2.90A/B1-303[»]
1MIAmodel-A57-193[»]
B211-303[»]
1SHJX-ray2.80A/B50-303[»]
1SHLX-ray3.00A/B57-303[»]
2QL5X-ray2.34A/C24-196[»]
B/D207-303[»]
2QL7X-ray2.40A/C24-196[»]
B/D207-303[»]
2QL9X-ray2.14A/C24-196[»]
B/D207-303[»]
2QLBX-ray2.25A/C24-196[»]
B/D207-303[»]
2QLFX-ray2.80A/C24-196[»]
B/D207-303[»]
2QLJX-ray2.60A/C24-196[»]
B/D207-303[»]
3EDRX-ray2.45A/C24-196[»]
B/D207-303[»]
3H1PX-ray2.61A/B50-303[»]
3IBCX-ray2.75A/C24-196[»]
B/D207-303[»]
3IBFX-ray2.50A/C24-196[»]
B/D207-303[»]
3R5KX-ray2.86A/B1-303[»]
4FDLX-ray2.80A/B2-303[»]
4FEAX-ray3.79A/B57-303[»]
4HQ0X-ray3.00A/B47-303[»]
4HQRX-ray3.00A/B47-303[»]
4JB8X-ray1.70A24-198[»]
B207-303[»]
4JJ8X-ray2.94A/B57-303[»]
4JR1X-ray2.15A/B57-303[»]
4JR2X-ray1.65A/B57-303[»]
4LSZX-ray2.26A/C24-198[»]
B/D207-303[»]
4ZVOX-ray2.85A/C1-198[»]
B/D199-303[»]
4ZVPX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVQX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVRX-ray2.30A/C1-198[»]
B/D199-303[»]
4ZVSX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVTX-ray2.85A/C1-198[»]
B/D199-303[»]
4ZVUX-ray2.60A/C1-198[»]
B/D199-303[»]
5IC6X-ray2.70A/C1-198[»]
B/D199-303[»]
5K20X-ray2.20A/C1-198[»]
B/D199-303[»]
5V6UX-ray2.80A/B1-303[»]
5V6ZX-ray2.60A/B1-303[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P55210

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P55210

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P55210

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C14A family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3573 Eukaryota
ENOG410ZQIE LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153232

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050802

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P55210

KEGG Orthology (KO)

More...
KOi
K04397

Database of Orthologous Groups

More...
OrthoDBi
984395at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P55210

TreeFam database of animal gene trees

More...
TreeFami
TF102023

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00032 CASc, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR015471 Casp3/7
IPR029030 Caspase-like_dom_sf
IPR033139 Caspase_cys_AS
IPR016129 Caspase_his_AS
IPR002398 Pept_C14
IPR002138 Pept_C14_p10
IPR001309 Pept_C14_p20
IPR015917 Pept_C14A

The PANTHER Classification System

More...
PANTHERi
PTHR10454 PTHR10454, 1 hit
PTHR10454:SF31 PTHR10454:SF31, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00376 IL1BCENZYME

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00115 CASc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52129 SSF52129, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01122 CASPASE_CYS, 1 hit
PS01121 CASPASE_HIS, 1 hit
PS50207 CASPASE_P10, 1 hit
PS50208 CASPASE_P20, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform Alpha (identifier: P55210-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADDQGCIEE QGVEDSANED SVDAKPDRSS FVPSLFSKKK KNVTMRSIKT
60 70 80 90 100
TRDRVPTYQY NMNFEKLGKC IIINNKNFDK VTGMGVRNGT DKDAEALFKC
110 120 130 140 150
FRSLGFDVIV YNDCSCAKMQ DLLKKASEED HTNAACFACI LLSHGEENVI
160 170 180 190 200
YGKDGVTPIK DLTAHFRGDR CKTLLEKPKL FFIQACRGTE LDDGIQADSG
210 220 230 240 250
PINDTDANPR YKIPVEADFL FAYSTVPGYY SWRSPGRGSW FVQALCSILE
260 270 280 290 300
EHGKDLEIMQ ILTRVNDRVA RHFESQSDDP HFHEKKQIPC VVSMLTKELY

FSQ
Length:303
Mass (Da):34,277
Last modified:October 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCD373EE54A232CA4
GO
Isoform Beta (identifier: P55210-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-303: VIYGKDGVTP...MLTKELYFSQ → MESCSVTQAG...TWKSCRSSPG

Note: Lacks enzymatic activity.
Show »
Length:253
Mass (Da):28,030
Checksum:i514964EF3F6229E1
GO
Isoform Alpha' (identifier: P55210-3) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDCVGWPPGRKWHLEKNTSCGGSSGICASYVTQM

Note: What we call isoform Alpha' is also known as Beta.1 Publication
Show »
Length:336
Mass (Da):37,815
Checksum:i34EEFF8AF5C318A2
GO
Isoform 4 (identifier: P55210-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLF → MQRGLFSDGDT

Show »
Length:278
Mass (Da):31,614
Checksum:iFAF2707D22D9CDE3
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRL7A0A0A0MRL7_HUMAN
Caspase-7
CASP7
388Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q5SVL2Q5SVL2_HUMAN
Caspase-7
CASP7
222Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti194G → A in AAC50346 (PubMed:8576161).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0486174D → E2 PublicationsCorresponds to variant dbSNP:rs11555408Ensembl.1
Natural variantiVAR_048618255D → E. Corresponds to variant dbSNP:rs2227310Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0453251 – 36MADDQ…VPSLF → MQRGLFSDGDT in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0008061M → MDCVGWPPGRKWHLEKNTSC GGSSGICASYVTQM in isoform Alpha'. 3 Publications1
Alternative sequenceiVSP_000807149 – 303VIYGK…LYFSQ → MESCSVTQAGVQRRDLGRLQ PPPPRLAEGPSLMMASRPTR GPSMTQMLILDTRSQWKLTS SSPIPRFQAITRGGAQEEAP GLCKPSAPSWRSTEKTWKSC RSSPG in isoform Beta. 1 PublicationAdd BLAST155

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U37448 mRNA Translation: AAC50303.1
U37449 mRNA Translation: AAC50304.1
U39613 mRNA Translation: AAC50346.1
U40281 mRNA Translation: AAC50352.1
U67319 mRNA Translation: AAC51152.1
U67320 mRNA Translation: AAC51153.1
U67206 mRNA Translation: AAF21460.1
BT006683 mRNA Translation: AAP35329.1
AB451281 mRNA Translation: BAG70095.1
AB451413 mRNA Translation: BAG70227.1
AK298964 mRNA Translation: BAG61059.1
AL592546 Genomic DNA No translation available.
AL627395 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49494.1
CH471066 Genomic DNA Translation: EAW49495.1
CH471066 Genomic DNA Translation: EAW49498.1
CH471066 Genomic DNA Translation: EAW49496.1
CH471066 Genomic DNA Translation: EAW49497.1
BC015799 mRNA Translation: AAH15799.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS58096.1 [P55210-4]
CCDS7580.1 [P55210-3]
CCDS7581.1 [P55210-1]
CCDS7582.1 [P55210-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001218.1, NM_001227.4 [P55210-1]
NP_001253985.1, NM_001267056.1 [P55210-1]
NP_001253986.1, NM_001267057.1
NP_001253987.1, NM_001267058.1 [P55210-4]
NP_001307840.1, NM_001320911.1
NP_203124.1, NM_033338.5 [P55210-3]
NP_203125.1, NM_033339.4 [P55210-1]
NP_203126.1, NM_033340.3 [P55210-2]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.9216

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000345633; ENSP00000298701; ENSG00000165806 [P55210-1]
ENST00000369315; ENSP00000358321; ENSG00000165806 [P55210-1]
ENST00000369318; ENSP00000358324; ENSG00000165806 [P55210-1]
ENST00000369331; ENSP00000358337; ENSG00000165806 [P55210-2]
ENST00000452490; ENSP00000398107; ENSG00000165806 [P55210-4]
ENST00000614447; ENSP00000478285; ENSG00000165806 [P55210-2]
ENST00000621345; ENSP00000480584; ENSG00000165806 [P55210-1]
ENST00000621607; ENSP00000478999; ENSG00000165806 [P55210-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
840

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:840

UCSC genome browser

More...
UCSCi
uc001lam.5 human [P55210-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U37448 mRNA Translation: AAC50303.1
U37449 mRNA Translation: AAC50304.1
U39613 mRNA Translation: AAC50346.1
U40281 mRNA Translation: AAC50352.1
U67319 mRNA Translation: AAC51152.1
U67320 mRNA Translation: AAC51153.1
U67206 mRNA Translation: AAF21460.1
BT006683 mRNA Translation: AAP35329.1
AB451281 mRNA Translation: BAG70095.1
AB451413 mRNA Translation: BAG70227.1
AK298964 mRNA Translation: BAG61059.1
AL592546 Genomic DNA No translation available.
AL627395 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49494.1
CH471066 Genomic DNA Translation: EAW49495.1
CH471066 Genomic DNA Translation: EAW49498.1
CH471066 Genomic DNA Translation: EAW49496.1
CH471066 Genomic DNA Translation: EAW49497.1
BC015799 mRNA Translation: AAH15799.1
CCDSiCCDS58096.1 [P55210-4]
CCDS7580.1 [P55210-3]
CCDS7581.1 [P55210-1]
CCDS7582.1 [P55210-2]
RefSeqiNP_001218.1, NM_001227.4 [P55210-1]
NP_001253985.1, NM_001267056.1 [P55210-1]
NP_001253986.1, NM_001267057.1
NP_001253987.1, NM_001267058.1 [P55210-4]
NP_001307840.1, NM_001320911.1
NP_203124.1, NM_033338.5 [P55210-3]
NP_203125.1, NM_033339.4 [P55210-1]
NP_203126.1, NM_033340.3 [P55210-2]
UniGeneiHs.9216

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1F1JX-ray2.35A/B2-303[»]
1GQFX-ray2.90A/B47-303[»]
1I4OX-ray2.40A/B24-303[»]
1I51X-ray2.45A/C51-198[»]
B/D199-303[»]
1K86X-ray2.60A/B51-303[»]
1K88X-ray2.70A/B51-303[»]
1KMCX-ray2.90A/B1-303[»]
1MIAmodel-A57-193[»]
B211-303[»]
1SHJX-ray2.80A/B50-303[»]
1SHLX-ray3.00A/B57-303[»]
2QL5X-ray2.34A/C24-196[»]
B/D207-303[»]
2QL7X-ray2.40A/C24-196[»]
B/D207-303[»]
2QL9X-ray2.14A/C24-196[»]
B/D207-303[»]
2QLBX-ray2.25A/C24-196[»]
B/D207-303[»]
2QLFX-ray2.80A/C24-196[»]
B/D207-303[»]
2QLJX-ray2.60A/C24-196[»]
B/D207-303[»]
3EDRX-ray2.45A/C24-196[»]
B/D207-303[»]
3H1PX-ray2.61A/B50-303[»]
3IBCX-ray2.75A/C24-196[»]
B/D207-303[»]
3IBFX-ray2.50A/C24-196[»]
B/D207-303[»]
3R5KX-ray2.86A/B1-303[»]
4FDLX-ray2.80A/B2-303[»]
4FEAX-ray3.79A/B57-303[»]
4HQ0X-ray3.00A/B47-303[»]
4HQRX-ray3.00A/B47-303[»]
4JB8X-ray1.70A24-198[»]
B207-303[»]
4JJ8X-ray2.94A/B57-303[»]
4JR1X-ray2.15A/B57-303[»]
4JR2X-ray1.65A/B57-303[»]
4LSZX-ray2.26A/C24-198[»]
B/D207-303[»]
4ZVOX-ray2.85A/C1-198[»]
B/D199-303[»]
4ZVPX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVQX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVRX-ray2.30A/C1-198[»]
B/D199-303[»]
4ZVSX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVTX-ray2.85A/C1-198[»]
B/D199-303[»]
4ZVUX-ray2.60A/C1-198[»]
B/D199-303[»]
5IC6X-ray2.70A/C1-198[»]
B/D199-303[»]
5K20X-ray2.20A/C1-198[»]
B/D199-303[»]
5V6UX-ray2.80A/B1-303[»]
5V6ZX-ray2.60A/B1-303[»]
ProteinModelPortaliP55210
SMRiP55210
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107290, 47 interactors
DIPiDIP-29973N
ELMiP55210
IntActiP55210, 18 interactors
MINTiP55210
STRINGi9606.ENSP00000358327

Chemistry databases

BindingDBiP55210
ChEMBLiCHEMBL3468
DrugBankiDB03384 Fica
DB05408 IDN-6556
GuidetoPHARMACOLOGYi1623

Protein family/group databases

MEROPSiC14.004

PTM databases

iPTMnetiP55210
PhosphoSitePlusiP55210

Polymorphism and mutation databases

BioMutaiCASP7
DMDMi1730092

Proteomic databases

EPDiP55210
jPOSTiP55210
MaxQBiP55210
PaxDbiP55210
PeptideAtlasiP55210
PRIDEiP55210
ProteomicsDBi56811
56812 [P55210-2]
56813 [P55210-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
840
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000345633; ENSP00000298701; ENSG00000165806 [P55210-1]
ENST00000369315; ENSP00000358321; ENSG00000165806 [P55210-1]
ENST00000369318; ENSP00000358324; ENSG00000165806 [P55210-1]
ENST00000369331; ENSP00000358337; ENSG00000165806 [P55210-2]
ENST00000452490; ENSP00000398107; ENSG00000165806 [P55210-4]
ENST00000614447; ENSP00000478285; ENSG00000165806 [P55210-2]
ENST00000621345; ENSP00000480584; ENSG00000165806 [P55210-1]
ENST00000621607; ENSP00000478999; ENSG00000165806 [P55210-3]
GeneIDi840
KEGGihsa:840
UCSCiuc001lam.5 human [P55210-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
840
DisGeNETi840
EuPathDBiHostDB:ENSG00000165806.19

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CASP7
HGNCiHGNC:1508 CASP7
HPAiCAB025563
MIMi601761 gene
neXtProtiNX_P55210
OpenTargetsiENSG00000165806
PharmGKBiPA26091

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3573 Eukaryota
ENOG410ZQIE LUCA
GeneTreeiENSGT00940000153232
HOVERGENiHBG050802
InParanoidiP55210
KOiK04397
OrthoDBi984395at2759
PhylomeDBiP55210
TreeFamiTF102023

Enzyme and pathway databases

BRENDAi3.4.22.60 2681
ReactomeiR-HSA-111459 Activation of caspases through apoptosome-mediated cleavage
R-HSA-111463 SMAC binds to IAPs
R-HSA-111464 SMAC-mediated dissociation of IAP:caspase complexes
R-HSA-111465 Apoptotic cleavage of cellular proteins
R-HSA-264870 Caspase-mediated cleavage of cytoskeletal proteins
SIGNORiP55210

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CASP7 human
EvolutionaryTraceiP55210

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Caspase_7

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
840
PMAP-CutDBiP55210

Protein Ontology

More...
PROi
PR:P55210

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000165806 Expressed in 211 organ(s), highest expression level in colonic mucosa
CleanExiHS_CASP7
ExpressionAtlasiP55210 baseline and differential
GenevisibleiP55210 HS

Family and domain databases

CDDicd00032 CASc, 1 hit
InterProiView protein in InterPro
IPR015471 Casp3/7
IPR029030 Caspase-like_dom_sf
IPR033139 Caspase_cys_AS
IPR016129 Caspase_his_AS
IPR002398 Pept_C14
IPR002138 Pept_C14_p10
IPR001309 Pept_C14_p20
IPR015917 Pept_C14A
PANTHERiPTHR10454 PTHR10454, 1 hit
PTHR10454:SF31 PTHR10454:SF31, 1 hit
PRINTSiPR00376 IL1BCENZYME
SMARTiView protein in SMART
SM00115 CASc, 1 hit
SUPFAMiSSF52129 SSF52129, 1 hit
PROSITEiView protein in PROSITE
PS01122 CASPASE_CYS, 1 hit
PS01121 CASPASE_HIS, 1 hit
PS50207 CASPASE_P10, 1 hit
PS50208 CASPASE_P20, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCASP7_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P55210
Secondary accession number(s): B4DQU7
, B5BU45, D3DRB8, Q13364, Q53YD5, Q5SVL0, Q5SVL3, Q96BA0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: January 16, 2019
This is version 200 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again