Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Caspase-7

Gene

CASP7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death.

Catalytic activityi

Strict requirement for an Asp residue at position P1 and has a preferred cleavage sequence of Asp-Glu-Val-Asp-|-.

Activity regulationi

Inhibited by isatin sulfonamides.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei144By similarity1
Active sitei1861

GO - Molecular functioni

  • cysteine-type endopeptidase activity Source: Reactome
  • cysteine-type endopeptidase activity involved in apoptotic process Source: GO_Central
  • cysteine-type endopeptidase activity involved in execution phase of apoptosis Source: CAFA
  • cysteine-type peptidase activity Source: ProtInc
  • peptidase activity Source: BHF-UCL

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
Biological processApoptosis

Enzyme and pathway databases

BRENDAi3.4.22.60 2681
ReactomeiR-HSA-111459 Activation of caspases through apoptosome-mediated cleavage
R-HSA-111463 SMAC binds to IAPs
R-HSA-111464 SMAC-mediated dissociation of IAP:caspase complexes
R-HSA-111465 Apoptotic cleavage of cellular proteins
R-HSA-264870 Caspase-mediated cleavage of cytoskeletal proteins
SIGNORiP55210

Protein family/group databases

MEROPSiC14.004

Names & Taxonomyi

Protein namesi
Recommended name:
Caspase-7 (EC:3.4.22.60)
Short name:
CASP-7
Alternative name(s):
Apoptotic protease Mch-3
CMH-1
ICE-like apoptotic protease 3
Short name:
ICE-LAP3
Cleaved into the following 2 chains:
Gene namesi
Name:CASP7
Synonyms:MCH3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000165806.19
HGNCiHGNC:1508 CASP7
MIMi601761 gene
neXtProtiNX_P55210

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi186C → A: No apoptotic activity. 1

Organism-specific databases

DisGeNETi840
OpenTargetsiENSG00000165806
PharmGKBiPA26091

Chemistry databases

ChEMBLiCHEMBL3468
DrugBankiDB03384 Fica
DB05408 IDN-6556
GuidetoPHARMACOLOGYi1623

Polymorphism and mutation databases

BioMutaiCASP7
DMDMi1730092

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
PropeptideiPRO_00000046162 – 23N-terminally processedAdd BLAST22
ChainiPRO_000000461724 – 198Caspase-7 subunit p20Add BLAST175
PropeptideiPRO_0000004618199 – 2068
ChainiPRO_0000004619207 – 303Caspase-7 subunit p11Add BLAST97

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1
Modified residuei37PhosphoserineCombined sources1

Post-translational modificationi

Cleavages by granzyme B or caspase-10 generate the two active subunits. Propeptide domains can also be cleaved efficiently by caspase-3. Active heterodimers between the small subunit of caspase-7 and the large subunit of caspase-3, and vice versa, also occur.1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein, Zymogen

Proteomic databases

EPDiP55210
MaxQBiP55210
PaxDbiP55210
PeptideAtlasiP55210
PRIDEiP55210
ProteomicsDBi56811
56812 [P55210-2]
56813 [P55210-3]

PTM databases

iPTMnetiP55210
PhosphoSitePlusiP55210

Miscellaneous databases

PMAP-CutDBiP55210

Expressioni

Tissue specificityi

Highly expressed in lung, skeletal muscle, liver, kidney, spleen and heart, and moderately in testis. No expression in the brain.

Gene expression databases

BgeeiENSG00000165806 Expressed in 211 organ(s), highest expression level in colonic mucosa
CleanExiHS_CASP7
ExpressionAtlasiP55210 baseline and differential
GenevisibleiP55210 HS

Organism-specific databases

HPAiCAB025563

Interactioni

Subunit structurei

Heterotetramer that consists of two anti-parallel arranged heterodimers, each one formed by a 20 kDa (p20) and a 11 kDa (p11) subunit. Interacts with BIRC6/bruce.2 Publications

Binary interactionsi

Protein-protein interaction databases

BioGridi107290, 47 interactors
DIPiDIP-29973N
ELMiP55210
IntActiP55210, 18 interactors
MINTiP55210
STRINGi9606.ENSP00000358327

Chemistry databases

BindingDBiP55210

Structurei

Secondary structure

1303
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP55210
SMRiP55210
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP55210

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase C14A family.Curated

Phylogenomic databases

eggNOGiKOG3573 Eukaryota
ENOG410ZQIE LUCA
GeneTreeiENSGT00760000118912
HOVERGENiHBG050802
InParanoidiP55210
KOiK04397
PhylomeDBiP55210
TreeFamiTF102023

Family and domain databases

CDDicd00032 CASc, 1 hit
InterProiView protein in InterPro
IPR015471 Casp3/7
IPR029030 Caspase-like_dom_sf
IPR033139 Caspase_cys_AS
IPR016129 Caspase_his_AS
IPR002398 Pept_C14
IPR002138 Pept_C14_p10
IPR001309 Pept_C14_p20
IPR015917 Pept_C14A
PANTHERiPTHR10454 PTHR10454, 1 hit
PTHR10454:SF31 PTHR10454:SF31, 1 hit
PRINTSiPR00376 IL1BCENZYME
SMARTiView protein in SMART
SM00115 CASc, 1 hit
SUPFAMiSSF52129 SSF52129, 1 hit
PROSITEiView protein in PROSITE
PS01122 CASPASE_CYS, 1 hit
PS01121 CASPASE_HIS, 1 hit
PS50207 CASPASE_P10, 1 hit
PS50208 CASPASE_P20, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform Alpha (identifier: P55210-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADDQGCIEE QGVEDSANED SVDAKPDRSS FVPSLFSKKK KNVTMRSIKT
60 70 80 90 100
TRDRVPTYQY NMNFEKLGKC IIINNKNFDK VTGMGVRNGT DKDAEALFKC
110 120 130 140 150
FRSLGFDVIV YNDCSCAKMQ DLLKKASEED HTNAACFACI LLSHGEENVI
160 170 180 190 200
YGKDGVTPIK DLTAHFRGDR CKTLLEKPKL FFIQACRGTE LDDGIQADSG
210 220 230 240 250
PINDTDANPR YKIPVEADFL FAYSTVPGYY SWRSPGRGSW FVQALCSILE
260 270 280 290 300
EHGKDLEIMQ ILTRVNDRVA RHFESQSDDP HFHEKKQIPC VVSMLTKELY

FSQ
Length:303
Mass (Da):34,277
Last modified:October 1, 1996 - v1
Checksum:iCD373EE54A232CA4
GO
Isoform Beta (identifier: P55210-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     149-303: VIYGKDGVTP...MLTKELYFSQ → MESCSVTQAG...TWKSCRSSPG

Note: Lacks enzymatic activity.
Show »
Length:253
Mass (Da):28,030
Checksum:i514964EF3F6229E1
GO
Isoform Alpha' (identifier: P55210-3) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDCVGWPPGRKWHLEKNTSCGGSSGICASYVTQM

Note: What we call isoform Alpha' is also known as Beta.1 Publication
Show »
Length:336
Mass (Da):37,815
Checksum:i34EEFF8AF5C318A2
GO
Isoform 4 (identifier: P55210-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MADDQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLF → MQRGLFSDGDT

Show »
Length:278
Mass (Da):31,614
Checksum:iFAF2707D22D9CDE3
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0A0MRL7A0A0A0MRL7_HUMAN
Caspase-7
CASP7
388Annotation score:
Q5SVL2Q5SVL2_HUMAN
Caspase-7
CASP7
222Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti194G → A in AAC50346 (PubMed:8576161).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_0486174D → E2 PublicationsCorresponds to variant dbSNP:rs11555408Ensembl.1
Natural variantiVAR_048618255D → E. Corresponds to variant dbSNP:rs2227310Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0453251 – 36MADDQ…VPSLF → MQRGLFSDGDT in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0008061M → MDCVGWPPGRKWHLEKNTSC GGSSGICASYVTQM in isoform Alpha'. 3 Publications1
Alternative sequenceiVSP_000807149 – 303VIYGK…LYFSQ → MESCSVTQAGVQRRDLGRLQ PPPPRLAEGPSLMMASRPTR GPSMTQMLILDTRSQWKLTS SSPIPRFQAITRGGAQEEAP GLCKPSAPSWRSTEKTWKSC RSSPG in isoform Beta. 1 PublicationAdd BLAST155

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U37448 mRNA Translation: AAC50303.1
U37449 mRNA Translation: AAC50304.1
U39613 mRNA Translation: AAC50346.1
U40281 mRNA Translation: AAC50352.1
U67319 mRNA Translation: AAC51152.1
U67320 mRNA Translation: AAC51153.1
U67206 mRNA Translation: AAF21460.1
BT006683 mRNA Translation: AAP35329.1
AB451281 mRNA Translation: BAG70095.1
AB451413 mRNA Translation: BAG70227.1
AK298964 mRNA Translation: BAG61059.1
AL592546 Genomic DNA No translation available.
AL627395 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49494.1
CH471066 Genomic DNA Translation: EAW49495.1
CH471066 Genomic DNA Translation: EAW49498.1
CH471066 Genomic DNA Translation: EAW49496.1
CH471066 Genomic DNA Translation: EAW49497.1
BC015799 mRNA Translation: AAH15799.1
CCDSiCCDS58096.1 [P55210-4]
CCDS7580.1 [P55210-3]
CCDS7581.1 [P55210-1]
CCDS7582.1 [P55210-2]
RefSeqiNP_001218.1, NM_001227.4 [P55210-1]
NP_001253985.1, NM_001267056.1 [P55210-1]
NP_001253986.1, NM_001267057.1
NP_001253987.1, NM_001267058.1 [P55210-4]
NP_001307840.1, NM_001320911.1
NP_203124.1, NM_033338.5 [P55210-3]
NP_203125.1, NM_033339.4 [P55210-1]
NP_203126.1, NM_033340.3 [P55210-2]
UniGeneiHs.9216

Genome annotation databases

EnsembliENST00000345633; ENSP00000298701; ENSG00000165806 [P55210-1]
ENST00000369315; ENSP00000358321; ENSG00000165806 [P55210-1]
ENST00000369318; ENSP00000358324; ENSG00000165806 [P55210-1]
ENST00000369331; ENSP00000358337; ENSG00000165806 [P55210-2]
ENST00000452490; ENSP00000398107; ENSG00000165806 [P55210-4]
ENST00000614447; ENSP00000478285; ENSG00000165806 [P55210-2]
ENST00000621345; ENSP00000480584; ENSG00000165806 [P55210-1]
ENST00000621607; ENSP00000478999; ENSG00000165806 [P55210-3]
GeneIDi840
KEGGihsa:840
UCSCiuc001lam.5 human [P55210-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U37448 mRNA Translation: AAC50303.1
U37449 mRNA Translation: AAC50304.1
U39613 mRNA Translation: AAC50346.1
U40281 mRNA Translation: AAC50352.1
U67319 mRNA Translation: AAC51152.1
U67320 mRNA Translation: AAC51153.1
U67206 mRNA Translation: AAF21460.1
BT006683 mRNA Translation: AAP35329.1
AB451281 mRNA Translation: BAG70095.1
AB451413 mRNA Translation: BAG70227.1
AK298964 mRNA Translation: BAG61059.1
AL592546 Genomic DNA No translation available.
AL627395 Genomic DNA No translation available.
CH471066 Genomic DNA Translation: EAW49494.1
CH471066 Genomic DNA Translation: EAW49495.1
CH471066 Genomic DNA Translation: EAW49498.1
CH471066 Genomic DNA Translation: EAW49496.1
CH471066 Genomic DNA Translation: EAW49497.1
BC015799 mRNA Translation: AAH15799.1
CCDSiCCDS58096.1 [P55210-4]
CCDS7580.1 [P55210-3]
CCDS7581.1 [P55210-1]
CCDS7582.1 [P55210-2]
RefSeqiNP_001218.1, NM_001227.4 [P55210-1]
NP_001253985.1, NM_001267056.1 [P55210-1]
NP_001253986.1, NM_001267057.1
NP_001253987.1, NM_001267058.1 [P55210-4]
NP_001307840.1, NM_001320911.1
NP_203124.1, NM_033338.5 [P55210-3]
NP_203125.1, NM_033339.4 [P55210-1]
NP_203126.1, NM_033340.3 [P55210-2]
UniGeneiHs.9216

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1F1JX-ray2.35A/B2-303[»]
1GQFX-ray2.90A/B47-303[»]
1I4OX-ray2.40A/B24-303[»]
1I51X-ray2.45A/C51-198[»]
B/D199-303[»]
1K86X-ray2.60A/B51-303[»]
1K88X-ray2.70A/B51-303[»]
1KMCX-ray2.90A/B1-303[»]
1MIAmodel-A57-193[»]
B211-303[»]
1SHJX-ray2.80A/B50-303[»]
1SHLX-ray3.00A/B57-303[»]
2QL5X-ray2.34A/C24-196[»]
B/D207-303[»]
2QL7X-ray2.40A/C24-196[»]
B/D207-303[»]
2QL9X-ray2.14A/C24-196[»]
B/D207-303[»]
2QLBX-ray2.25A/C24-196[»]
B/D207-303[»]
2QLFX-ray2.80A/C24-196[»]
B/D207-303[»]
2QLJX-ray2.60A/C24-196[»]
B/D207-303[»]
3EDRX-ray2.45A/C24-196[»]
B/D207-303[»]
3H1PX-ray2.61A/B50-303[»]
3IBCX-ray2.75A/C24-196[»]
B/D207-303[»]
3IBFX-ray2.50A/C24-196[»]
B/D207-303[»]
3R5KX-ray2.86A/B1-303[»]
4FDLX-ray2.80A/B2-303[»]
4FEAX-ray3.79A/B57-303[»]
4HQ0X-ray3.00A/B47-303[»]
4HQRX-ray3.00A/B47-303[»]
4JB8X-ray1.70A24-198[»]
B207-303[»]
4JJ8X-ray2.94A/B57-303[»]
4JR1X-ray2.15A/B57-303[»]
4JR2X-ray1.65A/B57-303[»]
4LSZX-ray2.26A/C24-198[»]
B/D207-303[»]
4ZVOX-ray2.85A/C1-198[»]
B/D199-303[»]
4ZVPX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVQX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVRX-ray2.30A/C1-198[»]
B/D199-303[»]
4ZVSX-ray2.50A/C1-198[»]
B/D199-303[»]
4ZVTX-ray2.85A/C1-198[»]
B/D199-303[»]
4ZVUX-ray2.60A/C1-198[»]
B/D199-303[»]
5IC6X-ray2.70A/C1-198[»]
B/D199-303[»]
5K20X-ray2.20A/C1-198[»]
B/D199-303[»]
5V6UX-ray2.80A/B1-303[»]
5V6ZX-ray2.60A/B1-303[»]
ProteinModelPortaliP55210
SMRiP55210
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107290, 47 interactors
DIPiDIP-29973N
ELMiP55210
IntActiP55210, 18 interactors
MINTiP55210
STRINGi9606.ENSP00000358327

Chemistry databases

BindingDBiP55210
ChEMBLiCHEMBL3468
DrugBankiDB03384 Fica
DB05408 IDN-6556
GuidetoPHARMACOLOGYi1623

Protein family/group databases

MEROPSiC14.004

PTM databases

iPTMnetiP55210
PhosphoSitePlusiP55210

Polymorphism and mutation databases

BioMutaiCASP7
DMDMi1730092

Proteomic databases

EPDiP55210
MaxQBiP55210
PaxDbiP55210
PeptideAtlasiP55210
PRIDEiP55210
ProteomicsDBi56811
56812 [P55210-2]
56813 [P55210-3]

Protocols and materials databases

DNASUi840
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000345633; ENSP00000298701; ENSG00000165806 [P55210-1]
ENST00000369315; ENSP00000358321; ENSG00000165806 [P55210-1]
ENST00000369318; ENSP00000358324; ENSG00000165806 [P55210-1]
ENST00000369331; ENSP00000358337; ENSG00000165806 [P55210-2]
ENST00000452490; ENSP00000398107; ENSG00000165806 [P55210-4]
ENST00000614447; ENSP00000478285; ENSG00000165806 [P55210-2]
ENST00000621345; ENSP00000480584; ENSG00000165806 [P55210-1]
ENST00000621607; ENSP00000478999; ENSG00000165806 [P55210-3]
GeneIDi840
KEGGihsa:840
UCSCiuc001lam.5 human [P55210-1]

Organism-specific databases

CTDi840
DisGeNETi840
EuPathDBiHostDB:ENSG00000165806.19
GeneCardsiCASP7
HGNCiHGNC:1508 CASP7
HPAiCAB025563
MIMi601761 gene
neXtProtiNX_P55210
OpenTargetsiENSG00000165806
PharmGKBiPA26091
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3573 Eukaryota
ENOG410ZQIE LUCA
GeneTreeiENSGT00760000118912
HOVERGENiHBG050802
InParanoidiP55210
KOiK04397
PhylomeDBiP55210
TreeFamiTF102023

Enzyme and pathway databases

BRENDAi3.4.22.60 2681
ReactomeiR-HSA-111459 Activation of caspases through apoptosome-mediated cleavage
R-HSA-111463 SMAC binds to IAPs
R-HSA-111464 SMAC-mediated dissociation of IAP:caspase complexes
R-HSA-111465 Apoptotic cleavage of cellular proteins
R-HSA-264870 Caspase-mediated cleavage of cytoskeletal proteins
SIGNORiP55210

Miscellaneous databases

ChiTaRSiCASP7 human
EvolutionaryTraceiP55210
GeneWikiiCaspase_7
GenomeRNAii840
PMAP-CutDBiP55210
PROiPR:P55210
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000165806 Expressed in 211 organ(s), highest expression level in colonic mucosa
CleanExiHS_CASP7
ExpressionAtlasiP55210 baseline and differential
GenevisibleiP55210 HS

Family and domain databases

CDDicd00032 CASc, 1 hit
InterProiView protein in InterPro
IPR015471 Casp3/7
IPR029030 Caspase-like_dom_sf
IPR033139 Caspase_cys_AS
IPR016129 Caspase_his_AS
IPR002398 Pept_C14
IPR002138 Pept_C14_p10
IPR001309 Pept_C14_p20
IPR015917 Pept_C14A
PANTHERiPTHR10454 PTHR10454, 1 hit
PTHR10454:SF31 PTHR10454:SF31, 1 hit
PRINTSiPR00376 IL1BCENZYME
SMARTiView protein in SMART
SM00115 CASc, 1 hit
SUPFAMiSSF52129 SSF52129, 1 hit
PROSITEiView protein in PROSITE
PS01122 CASPASE_CYS, 1 hit
PS01121 CASPASE_HIS, 1 hit
PS50207 CASPASE_P10, 1 hit
PS50208 CASPASE_P20, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCASP7_HUMAN
AccessioniPrimary (citable) accession number: P55210
Secondary accession number(s): B4DQU7
, B5BU45, D3DRB8, Q13364, Q53YD5, Q5SVL0, Q5SVL3, Q96BA0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: November 7, 2018
This is version 198 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Peptidase families
    Classification of peptidase families and list of entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again