Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
We are aiming to switch to the new UniProt website on Monday, May 9. Please explore and share your feedback. Take me to the new website.

UniProtKB - P55088 (AQP4_MOUSE)

Entry version 175 (23 Feb 2022)
Sequence version 2 (10 May 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Aquaporin-4

Gene

Aqp4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Forms a water-specific channel (PubMed:8660998, PubMed:9276712, PubMed:18286643).

Plays an important role in brain water homeostasis and in glymphatic solute transport (PubMed:22896675, PubMed:27751903, PubMed:30561329, PubMed:30557661).

Required for a normal rate of water exchange across the blood brain interface (PubMed:30557661).

Required for normal levels of cerebrospinal fluid influx into the brain cortex and parenchyma along paravascular spaces that surround penetrating arteries, and for normal drainage of interstitial fluid along paravenous drainage pathways. Thereby, it is required for normal clearance of solutes from the brain interstitial fluid, including soluble beta-amyloid peptides derived from APP (PubMed:22896675, PubMed:27751903, PubMed:30561329).

Plays a redundant role in urinary water homeostasis and urinary concentrating ability (PubMed:9276712).

7 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-MMU-432040, Vasopressin regulates renal water homeostasis via Aquaporins
R-MMU-432047, Passive transport by Aquaporins

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Aquaporin-4
Short name:
AQP-4
Alternative name(s):
Mercurial-insensitive water channel1 Publication
Short name:
MIWC1 Publication
WCH4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Aqp4
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...MGIi		MGI:107387, Aqp4

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSMUSG00000024411

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 36CytoplasmicCuratedAdd BLAST36
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei37 – 57HelicalBy similarityAdd BLAST21
Topological domaini58 – 69ExtracellularCuratedAdd BLAST12
Transmembranei70 – 89HelicalBy similarityAdd BLAST20
Topological domaini90 – 93CytoplasmicCurated4
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei94 – 101Discontinuously helicalBy similarity8
Topological domaini102 – 115CytoplasmicCuratedAdd BLAST14
Transmembranei116 – 136HelicalBy similarityAdd BLAST21
Topological domaini137 – 155ExtracellularCuratedAdd BLAST19
Transmembranei156 – 176HelicalBy similarityAdd BLAST21
Topological domaini177 – 184CytoplasmicCurated8
Transmembranei185 – 205HelicalBy similarityAdd BLAST21
Topological domaini206 – 208ExtracellularCurated3
Intramembranei209 – 222Discontinuously helicalBy similarityAdd BLAST14
Topological domaini223 – 231ExtracellularCurated9
Transmembranei232 – 252HelicalBy similarityAdd BLAST21
Topological domaini253 – 323CytoplasmicCuratedAdd BLAST71

Keywords - Cellular componenti

Cell membrane, Cell projection, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Mice are born at the expected Mendelian rate and display no obvious phenotype (PubMed:9276712, PubMed:10915655). They have normal urine osmolality under standard conditions, but display reduced urine osmolality after 36 hour water deprivation (PubMed:9276712). Adult mice display incereased brain water content (PubMed:27751903). Mutant mice display a reduced rate of water flux across the blood brain interface (PubMed:30557661). Fluid transport from the brain paravascular space into the surrounding interstitium is abolished. Besides, mice display strongly reduced solute clearance from the brain interstitium (PubMed:22896675). Mice display reduced cerebrospinal fluid influx into the brain, and reduced brain solute transport via the cerebrospinal fluid from the cisterna to the brain parenchyma (PubMed:22896675, PubMed:30561329). The organ of Corti in the inner ear appears morphologically normal, but mice have considerably impaired hearing at an age of 4 to 5 weeks (PubMed:11406631). Mice display unchanged gastric acid secretion (PubMed:10915655).7 Publications

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi111S → A: Loss of phosphorylation by PKG (in vitro). No effect on location at cell membrane. 1 Publication1

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL5965

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000639491 – 323Aquaporin-4Add BLAST323

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi13S-palmitoyl cysteineBy similarity1
Lipidationi17S-palmitoyl cysteineBy similarity1
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei111Phosphoserine; by PKG1 Publication1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi153N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei180Phosphoserine; by PKCBy similarity1
Glycosylationi206N-linked (GlcNAc...) asparagineSequence analysis1
Modified residuei276PhosphoserineBy similarity1
Modified residuei285PhosphoserineCombined sources1
Modified residuei289PhosphothreonineCombined sources1
Modified residuei321PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation by PKC at Ser-180 reduces conductance by 50% (By similarity). Phosphorylation by PKG at Ser-111 in response to glutamate increases conductance by 40%; this increase is not due to increased presence at the cell membrane (PubMed:18286643).By similarity1 Publication
Isoform 2: Palmitoylated on its N-terminal region. Isoform 1: Not palmitoylated.By similarity

Keywords - PTMi

Glycoprotein, Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

MaxQB - The MaxQuant DataBase

More...MaxQBi		P55088

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P55088

PeptideAtlas

More...PeptideAtlasi		P55088

PRoteomics IDEntifications database

More...PRIDEi		P55088

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		273910 [P55088-1]
273911 [P55088-2]
273912 [P55088-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P55088, 2 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P55088

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P55088

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Detected in brain cortex, especially around cortical blood vessels, and subjacent to pia, with lower levels in parenchymal membranes (PubMed:27751903). Detected in ependymal and astroglial cells in brain (PubMed:8660998, PubMed:9276712, PubMed:22896675, PubMed:27751903). Detected in supporting Hensen's cells, inner sulcus cells and Claudius cells in the inner ear (PubMed:11406631). Detected in skeletal muscle (PubMed:29055082). Detected in gastric parietal cells (PubMed:10915655). Detected in principal cells in collecting ducts in kidney medulla (at protein level) (PubMed:9276712, PubMed:16641094). Detected in brain, heart and skeletal muscle (PubMed:8660998).8 Publications

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P55088, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer. The tetramers can form oligomeric arrays in membranes. The size of the oligomers differs between tissues and is smaller in skeletal muscle than in brain. Interaction between AQP4 oligomeric arrays in close-by cells can contribute to cell-cell adhesion (By similarity).

Part of a complex containing MLC1, TRPV4, HEPACAM and ATP1B1 (By similarity).

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		198173, 9 interactors

Database of interacting proteins

More...DIPi		DIP-59602N

Protein interaction database and analysis system

More...IntActi		P55088, 2 interactors

STRING: functional protein association networks

More...STRINGi		10090.ENSMUSP00000078088

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P55088, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P55088

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi97 – 99NPA 1By similarity3
Motifi213 – 215NPA 2By similarity3

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Aquaporins contain two tandem repeats each containing three membrane-spanning domains and a pore-forming loop with the signature motif Asn-Pro-Ala (NPA).By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MIP/aquaporin (TC 1.A.8) family. [View classification]Curated

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0223, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156037

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P55088

Database of Orthologous Groups

More...OrthoDBi		1152704at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P55088

TreeFam database of animal gene trees

More...TreeFami		TF312940

Family and domain databases

Conserved Domains Database

More...CDDi		cd00333, MIP, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.1080.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR023271, Aquaporin-like
IPR034294, Aquaporin_transptr
IPR000425, MIP
IPR022357, MIP_CS

The PANTHER Classification System

More...PANTHERi		PTHR19139, PTHR19139, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00230, MIP, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00783, MINTRINSICP

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF81338, SSF81338, 1 hit

TIGRFAMs; a protein family database

More...TIGRFAMsi		TIGR00861, MIP, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00221, MIP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: P55088-1) [UniParc]FASTAAdd to basket
Also known as: MIWC2, AQP4-M1

This isoform has been chosen as the <p><strong>What is the canonical sequence?</strong><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDGAAARRW GKCGHSCSRE SIMVAFKGVW TQAFWKAVSA EFLATLIFVL 
        60         70         80         90        100
LGVGSTINWG GSENPLPVDM VLISLCFGLS IATMVQCFGH ISGGHINPAV 
       110        120        130        140        150
TVAMVCTRKI SIAKSVFYII AQCLGAIIGA GILYLVTPPS VVGGLGVTTV 
       160        170        180        190        200
HGNLTAGHGL LVELIITFQL VFTIFASCDS KRTDVTGSIA LAIGFSVAIG 
       210        220        230        240        250
HLFAINYTGA SMNPARSFGP AVIMGNWANH WIYWVGPIMG AVLAGALYEY 
       260        270        280        290        300
VFCPDVELKR RLKEAFSKAA QQTKGSYMEV EDNRSQVETE DLILKPGVVH 
       310        320 
VIDIDRGEEK KGKDSSGEVL SSV
Length:323
Mass (Da):34,436
Last modified:May 10, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9AC638A3C3F412E2
GO
Isoform 1 (identifier: P55088-2) [UniParc]FASTAAdd to basket
Also known as: MIWC1, AQP4-M23

The sequence of this isoform differs from the canonical sequence as follows:
     1-22: Missing.

Show »
Length:301
Mass (Da):32,088
Checksum:iE2ADDA3C8E0A92A2
GO
Isoform 3 (identifier: P55088-3) [UniParc]FASTAAdd to basket
Also known as: MIWC3

The sequence of this isoform differs from the canonical sequence as follows:
     1-11: MSDGAAARRWG → MVHGFGCFVFFFLISLSSLWASEDSTCNSTLPLCHLATTLDCC

Show »
Length:355
Mass (Da):37,977
Checksum:iCDA0A8D89A1AC74A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A5F8MQ17A0A5F8MQ17_MOUSE
Aquaporin-4
Aqp4
330Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0R4J0Z3A0A0R4J0Z3_MOUSE
Aquaporin-4
Aqp4
323Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A3Q4EI78A0A3Q4EI78_MOUSE
Aquaporin-4
Aqp4
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti37A → S in AAB41571 (PubMed:8660998).Curated1
Sequence conflicti51Missing in AAB41569 (PubMed:8660998).Curated1
Sequence conflicti51Missing in AAB41570 (PubMed:8660998).Curated1
Sequence conflicti88F → L in AAB41569 (PubMed:8660998).Curated1
Sequence conflicti88F → L in AAB41570 (PubMed:8660998).Curated1
Sequence conflicti174I → V in AAB41569 (PubMed:8660998).Curated1
Sequence conflicti174I → V in AAB41570 (PubMed:8660998).Curated1
Sequence conflicti313K → R in AAB41569 (PubMed:8660998).Curated1
Sequence conflicti313K → R in AAB41570 (PubMed:8660998).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural varianti4G → R1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0032331 – 22Missing in isoform 1. 3 PublicationsAdd BLAST22
Alternative sequenceiVSP_0032341 – 11MSDGAAARRWG → MVHGFGCFVFFFLISLSSLW ASEDSTCNSTLPLCHLATTL DCC in isoform 3. 1 PublicationAdd BLAST11

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
U48398 mRNA Translation: AAB41569.1
U48397 mRNA Translation: AAB41568.1
U33012 mRNA Translation: AAA84923.1
U48400 Genomic DNA Translation: AAB41571.1
U48399 mRNA Translation: AAB41570.1
U88623 mRNA Translation: AAC53155.1
AF469168 mRNA Translation: AAL73545.1
AF469169 mRNA Translation: AAL73546.1
AF219992 Genomic DNA Translation: AAG44243.2
CT010362 mRNA Translation: CAJ18569.1
BC024526 mRNA Translation: AAH24526.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS29073.1 [P55088-1]
CCDS89196.1 [P55088-2]

NCBI Reference Sequences

More...RefSeqi		NP_001295570.1, NM_001308641.1 [P55088-2]
NP_001295571.1, NM_001308642.1 [P55088-2]
NP_001295572.1, NM_001308643.1 [P55088-2]
NP_001295573.1, NM_001308644.1 [P55088-2]
NP_001295574.1, NM_001308645.1 [P55088-2]
NP_001295575.1, NM_001308646.1 [P55088-2]
NP_001295576.1, NM_001308647.2 [P55088-2]
NP_001304658.1, NM_001317729.1
NP_033830.2, NM_009700.3

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSMUST00000234053; ENSMUSP00000157337; ENSMUSG00000024411 [P55088-2]
ENSMUST00000234391; ENSMUSP00000157347; ENSMUSG00000024411 [P55088-2]
ENSMUST00000234466; ENSMUSP00000157324; ENSMUSG00000024411 [P55088-2]
ENSMUST00000234473; ENSMUSP00000157152; ENSMUSG00000024411 [P55088-2]
ENSMUST00000234518; ENSMUSP00000157239; ENSMUSG00000024411 [P55088-2]
ENSMUST00000234643; ENSMUSP00000157060; ENSMUSG00000024411 [P55088-2]
ENSMUST00000235044; ENSMUSP00000157000; ENSMUSG00000024411 [P55088-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		11829

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		mmu:11829

UCSC genome browser

More...UCSCi		uc008edq.2, mouse [P55088-1]
uc008eds.2, mouse [P55088-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U48398 mRNA Translation: AAB41569.1
U48397 mRNA Translation: AAB41568.1
U33012 mRNA Translation: AAA84923.1
U48400 Genomic DNA Translation: AAB41571.1
U48399 mRNA Translation: AAB41570.1
U88623 mRNA Translation: AAC53155.1
AF469168 mRNA Translation: AAL73545.1
AF469169 mRNA Translation: AAL73546.1
AF219992 Genomic DNA Translation: AAG44243.2
CT010362 mRNA Translation: CAJ18569.1
BC024526 mRNA Translation: AAH24526.1
CCDSiCCDS29073.1 [P55088-1]
CCDS89196.1 [P55088-2]
RefSeqiNP_001295570.1, NM_001308641.1 [P55088-2]
NP_001295571.1, NM_001308642.1 [P55088-2]
NP_001295572.1, NM_001308643.1 [P55088-2]
NP_001295573.1, NM_001308644.1 [P55088-2]
NP_001295574.1, NM_001308645.1 [P55088-2]
NP_001295575.1, NM_001308646.1 [P55088-2]
NP_001295576.1, NM_001308647.2 [P55088-2]
NP_001304658.1, NM_001317729.1
NP_033830.2, NM_009700.3

3D structure databases

SMRiP55088
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi198173, 9 interactors
DIPiDIP-59602N
IntActiP55088, 2 interactors
STRINGi10090.ENSMUSP00000078088

Chemistry databases

ChEMBLiCHEMBL5965

PTM databases

GlyGeniP55088, 2 sites
iPTMnetiP55088
PhosphoSitePlusiP55088

Proteomic databases

MaxQBiP55088
PaxDbiP55088
PeptideAtlasiP55088
PRIDEiP55088
ProteomicsDBi273910 [P55088-1]
273911 [P55088-2]
273912 [P55088-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		3103, 580 antibodies from 37 providers

The DNASU plasmid repository

More...DNASUi		11829

Genome annotation databases

EnsembliENSMUST00000234053; ENSMUSP00000157337; ENSMUSG00000024411 [P55088-2]
ENSMUST00000234391; ENSMUSP00000157347; ENSMUSG00000024411 [P55088-2]
ENSMUST00000234466; ENSMUSP00000157324; ENSMUSG00000024411 [P55088-2]
ENSMUST00000234473; ENSMUSP00000157152; ENSMUSG00000024411 [P55088-2]
ENSMUST00000234518; ENSMUSP00000157239; ENSMUSG00000024411 [P55088-2]
ENSMUST00000234643; ENSMUSP00000157060; ENSMUSG00000024411 [P55088-2]
ENSMUST00000235044; ENSMUSP00000157000; ENSMUSG00000024411 [P55088-2]
GeneIDi11829
KEGGimmu:11829
UCSCiuc008edq.2, mouse [P55088-1]
uc008eds.2, mouse [P55088-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		361
MGIiMGI:107387, Aqp4
VEuPathDBiHostDB:ENSMUSG00000024411

Phylogenomic databases

eggNOGiKOG0223, Eukaryota
GeneTreeiENSGT00940000156037
InParanoidiP55088
OrthoDBi1152704at2759
PhylomeDBiP55088
TreeFamiTF312940

Enzyme and pathway databases

ReactomeiR-MMU-432040, Vasopressin regulates renal water homeostasis via Aquaporins
R-MMU-432047, Passive transport by Aquaporins

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		11829, 0 hits in 63 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		Aqp4, mouse

Protein Ontology

More...PROi		PR:P55088
RNActiP55088, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

ExpressionAtlasiP55088, baseline and differential

Family and domain databases

CDDicd00333, MIP, 1 hit
Gene3Di1.20.1080.10, 1 hit
InterProiView protein in InterPro
IPR023271, Aquaporin-like
IPR034294, Aquaporin_transptr
IPR000425, MIP
IPR022357, MIP_CS
PANTHERiPTHR19139, PTHR19139, 1 hit
PfamiView protein in Pfam
PF00230, MIP, 1 hit
PRINTSiPR00783, MINTRINSICP
SUPFAMiSSF81338, SSF81338, 1 hit
TIGRFAMsiTIGR00861, MIP, 1 hit
PROSITEiView protein in PROSITE
PS00221, MIP, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAQP4_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P55088
Secondary accession number(s): P97818
, Q4FJP1, Q61131, Q61132, Q8VHE4, Q8VHE5, Q9EQI3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: May 10, 2004
Last modified: February 23, 2022
This is version 175 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again