Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P55061 (BI1_HUMAN)

Entry version 172 (11 Dec 2019)
Sequence version 2 (15 May 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Bax inhibitor 1

Gene

TMBIM6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Suppressor of apoptosis (PubMed:21075086). Modulates unfolded protein response signaling (PubMed:21075086). Modulates ER calcium homeostasis by acting as a calcium-leak channel (PubMed:22128171). Negatively regulates autophagy and autophagosome formation, especially during periods of nutrient deprivation, and reduces cell survival during starvation (By similarity).By similarity2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, Autophagy, Unfolded protein response
LigandCalcium

Protein family/group databases

Transport Classification Database

More...TCDBi		1.A.14.1.1 the calcium transporter a (cata) (formerly the testis-enhanced gene transfer (tegt) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Bax inhibitor 1
Short name:
BI-1
Alternative name(s):
Testis-enhanced gene transcript protein
Transmembrane BAX inhibitor motif-containing protein 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TMBIM6
Synonyms:BI1, TEGT
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000139644.12

Human Gene Nomenclature Database

More...HGNCi		HGNC:11723 TMBIM6

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		600748 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P55061

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 29CytoplasmicSequence analysisAdd BLAST29
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei30 – 50HelicalSequence analysisAdd BLAST21
Topological domaini51 – 52LumenalSequence analysis2
Transmembranei53 – 73HelicalSequence analysisAdd BLAST21
Topological domaini74 – 86CytoplasmicSequence analysisAdd BLAST13
Transmembranei87 – 107HelicalSequence analysisAdd BLAST21
Topological domaini108 – 112LumenalSequence analysis5
Transmembranei113 – 133HelicalSequence analysisAdd BLAST21
Topological domaini134 – 139CytoplasmicSequence analysis6
Transmembranei140 – 160HelicalSequence analysisAdd BLAST21
Topological domaini161 – 166LumenalSequence analysis6
Transmembranei167 – 187HelicalSequence analysisAdd BLAST21
Topological domaini188 – 206CytoplasmicSequence analysisAdd BLAST19
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei207 – 227HelicalSequence analysisAdd BLAST21
Topological domaini228 – 237CytoplasmicSequence analysis10

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi209D → A: Abolishes calcium flux properties. 1 Publication1
Mutagenesisi213D → A: Abolishes calcium flux properties. 1 Publication1

Organism-specific databases

DisGeNET

More...DisGeNETi		7009

Open Targets

More...OpenTargetsi		ENSG00000139644

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36440

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P55061 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TMBIM6

Domain mapping of disease mutations (DMDM)

More...DMDMi		20981681

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001790781 – 237Bax inhibitor 1Add BLAST237

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki7Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P55061

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P55061

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P55061

MaxQB - The MaxQuant DataBase

More...MaxQBi		P55061

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P55061

PeptideAtlas

More...PeptideAtlasi		P55061

PRoteomics IDEntifications database

More...PRIDEi		P55061

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		29424
56774 [P55061-1]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		P55061-1 [P55061-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P55061

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P55061

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P55061

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly abundant in testis.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000139644 Expressed in 237 organ(s), highest expression level in cortex of kidney

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P55061 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P55061 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA017378

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with BCL2 and BCL2L1.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		112868, 32 interactors

Protein interaction database and analysis system

More...IntActi		P55061, 73 interactors

Molecular INTeraction database

More...MINTi		P55061

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000389277

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P55061 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The intra-membrane loop at the C-terminus acts as a calcium pore, mediating calcium leak from the ER into the cytosol.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the BI1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1629 Eukaryota
ENOG4111GCT LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00980000198543

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000238748

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P55061

KEGG Orthology (KO)

More...KOi		K21889

Identification of Orthologs from Complete Genome Data

More...OMAi		PVRQHLK

Database of Orthologous Groups

More...OrthoDBi		1275249at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P55061

TreeFam database of animal gene trees

More...TreeFami		TF323395

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR006213 Bax_inhbtr1_CS
IPR006214 Bax_inhibitor_1-related

The PANTHER Classification System

More...PANTHERi		PTHR23291 PTHR23291, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01027 Bax1-I, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS01243 BI1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 13 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P55061-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNIFDRKINF DALLKFSHIT PSTQQHLKKV YASFALCMFV AAAGAYVHMV 
        60         70         80         90        100
THFIQAGLLS ALGSLILMIW LMATPHSHET EQKRLGLLAG FAFLTGVGLG 
       110        120        130        140        150
PALEFCIAVN PSILPTAFMG TAMIFTCFTL SALYARRRSY LFLGGILMSA 
       160        170        180        190        200
LSLLLLSSLG NVFFGSIWLF QANLYVGLVV MCGFVLFDTQ LIIEKAEHGD 
       210        220        230 
QDYIWHCIDL FLDFITVFRK LMMILAMNEK DKKKEKK
Length:237
Mass (Da):26,538
Last modified:May 15, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6567E73A1AD6238E
GO
Isoform 2 (identifier: P55061-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSHSSVTREAPQLLSQRQRREVRGVWGWGCLPGPRGGPALFGLVTFGQSGDCCTDSGTM

Show »
Length:295
Mass (Da):32,711
Checksum:i7C3E89A2DBE8373E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 13 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VQQ5F8VQQ5_HUMAN
Bax inhibitor 1
TMBIM6
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VSI7F8VSI7_HUMAN
Bax inhibitor 1
TMBIM6
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VVJ4F8VVJ4_HUMAN
Bax inhibitor 1
TMBIM6
145Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VR05F8VR05_HUMAN
Bax inhibitor 1
TMBIM6
113Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W086F8W086_HUMAN
Bax inhibitor 1
TMBIM6
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VPI1F8VPI1_HUMAN
Bax inhibitor 1
TMBIM6
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W201F8W201_HUMAN
Bax inhibitor 1
TMBIM6
95Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W1V3F8W1V3_HUMAN
Bax inhibitor 1
TMBIM6
200Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VQW0F8VQW0_HUMAN
Bax inhibitor 1
TMBIM6
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VX73F8VX73_HUMAN
Bax inhibitor 1
TMBIM6
44Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti118F → L in AAU29521 (Ref. 2) Curated1
Sequence conflicti169L → P in CAA53472 (PubMed:8530040).Curated1
Sequence conflicti187F → V in CAA53472 (PubMed:8530040).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0551191M → MSHSSVTREAPQLLSQRQRR EVRGVWGWGCLPGPRGGPAL FGLVTFGQSGDCCTDSGTM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X75861 mRNA Translation: CAA53472.1
AF033095 mRNA Translation: AAB87479.1
AY736129 mRNA Translation: AAU29521.1
AK312238 mRNA Translation: BAG35171.1
AC020612 Genomic DNA No translation available.
AC084037 Genomic DNA No translation available.
AC131157 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58089.1
BC000916 mRNA Translation: AAH00916.1
BC036203 mRNA Translation: AAH36203.2

The Consensus CDS (CCDS) project

More...CCDSi		CCDS31797.1 [P55061-1]
CCDS44875.1 [P55061-2]

Protein sequence database of the Protein Information Resource

More...PIRi		I38334

NCBI Reference Sequences

More...RefSeqi		NP_001092046.1, NM_001098576.1 [P55061-2]
NP_003208.2, NM_003217.2 [P55061-1]
XP_005269183.1, XM_005269126.3 [P55061-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000267115; ENSP00000267115; ENSG00000139644 [P55061-1]
ENST00000395006; ENSP00000378454; ENSG00000139644 [P55061-1]
ENST00000423828; ENSP00000389277; ENSG00000139644 [P55061-2]
ENST00000549385; ENSP00000448036; ENSG00000139644 [P55061-1]
ENST00000552370; ENSP00000450158; ENSG00000139644 [P55061-1]
ENST00000552699; ENSP00000446734; ENSG00000139644 [P55061-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		7009

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:7009

UCSC genome browser

More...UCSCi		uc001rux.3 human [P55061-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X75861 mRNA Translation: CAA53472.1
AF033095 mRNA Translation: AAB87479.1
AY736129 mRNA Translation: AAU29521.1
AK312238 mRNA Translation: BAG35171.1
AC020612 Genomic DNA No translation available.
AC084037 Genomic DNA No translation available.
AC131157 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58089.1
BC000916 mRNA Translation: AAH00916.1
BC036203 mRNA Translation: AAH36203.2
CCDSiCCDS31797.1 [P55061-1]
CCDS44875.1 [P55061-2]
PIRiI38334
RefSeqiNP_001092046.1, NM_001098576.1 [P55061-2]
NP_003208.2, NM_003217.2 [P55061-1]
XP_005269183.1, XM_005269126.3 [P55061-2]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGridi112868, 32 interactors
IntActiP55061, 73 interactors
MINTiP55061
STRINGi9606.ENSP00000389277

Protein family/group databases

TCDBi1.A.14.1.1 the calcium transporter a (cata) (formerly the testis-enhanced gene transfer (tegt) family

PTM databases

iPTMnetiP55061
PhosphoSitePlusiP55061
SwissPalmiP55061

Polymorphism and mutation databases

BioMutaiTMBIM6
DMDMi20981681

Proteomic databases

EPDiP55061
jPOSTiP55061
MassIVEiP55061
MaxQBiP55061
PaxDbiP55061
PeptideAtlasiP55061
PRIDEiP55061
ProteomicsDBi29424
56774 [P55061-1]
TopDownProteomicsiP55061-1 [P55061-1]

Genome annotation databases

EnsembliENST00000267115; ENSP00000267115; ENSG00000139644 [P55061-1]
ENST00000395006; ENSP00000378454; ENSG00000139644 [P55061-1]
ENST00000423828; ENSP00000389277; ENSG00000139644 [P55061-2]
ENST00000549385; ENSP00000448036; ENSG00000139644 [P55061-1]
ENST00000552370; ENSP00000450158; ENSG00000139644 [P55061-1]
ENST00000552699; ENSP00000446734; ENSG00000139644 [P55061-2]
GeneIDi7009
KEGGihsa:7009
UCSCiuc001rux.3 human [P55061-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		7009
DisGeNETi7009
EuPathDBiHostDB:ENSG00000139644.12

GeneCards: human genes, protein and diseases

More...GeneCardsi		TMBIM6
HGNCiHGNC:11723 TMBIM6
HPAiHPA017378
MIMi600748 gene
neXtProtiNX_P55061
OpenTargetsiENSG00000139644
PharmGKBiPA36440

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1629 Eukaryota
ENOG4111GCT LUCA
GeneTreeiENSGT00980000198543
HOGENOMiHOG000238748
InParanoidiP55061
KOiK21889
OMAiPVRQHLK
OrthoDBi1275249at2759
PhylomeDBiP55061
TreeFamiTF323395

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TMBIM6 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TEGT

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		7009
PharosiP55061 Tbio

Protein Ontology

More...PROi		PR:P55061
RNActiP55061 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000139644 Expressed in 237 organ(s), highest expression level in cortex of kidney
ExpressionAtlasiP55061 baseline and differential
GenevisibleiP55061 HS

Family and domain databases

InterProiView protein in InterPro
IPR006213 Bax_inhbtr1_CS
IPR006214 Bax_inhibitor_1-related
PANTHERiPTHR23291 PTHR23291, 1 hit
PfamiView protein in Pfam
PF01027 Bax1-I, 1 hit
PROSITEiView protein in PROSITE
PS01243 BI1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBI1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P55061
Secondary accession number(s): B2R5M4
, F8W034, O14938, Q643A7, Q96J50
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: May 15, 2002
Last modified: December 11, 2019
This is version 172 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again