TMBIM6

Functionⁱ

Suppressor of apoptosis (PubMed:21075086). Modulates unfolded protein response signaling (PubMed:21075086). Modulates ER calcium homeostasis by acting as a calcium-leak channel (PubMed:22128171). Negatively regulates autophagy and autophagosome formation, especially during periods of nutrient deprivation, and reduces cell survival during starvation (By similarity).By similarity2 Publications

GO - Molecular functionⁱ

endoribonuclease inhibitor activity
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 19328063
enzyme binding
Source: ParkinsonsUK-UCL
Inferred from physical interactionⁱ
- 19328063
ubiquitin protein ligase binding
Source: ParkinsonsUK-UCL
Inferred from physical interactionⁱ
- 21068390

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

autophagy Source: UniProtKB-KW
cellular response to unfolded protein
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 19328063
endoplasmic reticulum calcium ion homeostasis Source: Ensembl
intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress Source: Ensembl
negative regulation of apoptotic process
Source: ParkinsonsUK-UCL
Inferred from genetic interactionⁱ
- 9660918
negative regulation of apoptotic signaling pathway
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 21075086
negative regulation of calcium ion transport into cytosol
Source: MGI
Inferred from direct assayⁱ
- 26582200
negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 21075086
negative regulation of endoribonuclease activity
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 19328063
negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 21075086
negative regulation of immunoglobulin secretion Source: Ensembl
negative regulation of protein binding
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 19328063
negative regulation of RNA splicing
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 19328063
negative regulation of transcription from RNA polymerase II promoter in response to endoplasmic reticulum stress Source: Ensembl
response to L-glutamate
Source: ParkinsonsUK-UCL
Inferred from direct assayⁱ
- 21075086

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Biological process	Apoptosis, Autophagy, Unfolded protein response
Ligand	Calcium

Protein family/group databases

TCDBⁱ	1.A.14.1.1 the calcium transporter a (cata) (formerly the testis-enhanced gene transfer (tegt) family

TCDBⁱ

1.A.14.1.1 the calcium transporter a (cata) (formerly the testis-enhanced gene transfer (tegt) family

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Bax inhibitor 1 Short name: BI-1 Alternative name(s): Testis-enhanced gene transcript protein Transmembrane BAX inhibitor motif-containing protein 6
Gene namesⁱ	Name:TMBIM6 Synonyms:BI1, TEGT
Organismⁱ	Homo sapiens (Human)
Taxonomic identifierⁱ	9606 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo
Proteomesⁱ	UP000005640 Componentⁱ: Chromosome 12

Organism-specific databases

EuPathDBⁱ	HostDB:ENSG00000139644.12
Human Gene Nomenclature Database More...HGNCⁱ	HGNC:11723 TMBIM6
MIMⁱ	600748 gene
neXtProtⁱ	NX_P55061

Topology

Feature key	Position(s)	DescriptionActions	Length
Topological domainⁱ	1 – 29	CytoplasmicSequence analysisAdd BLAST	29
Transmembraneⁱ	30 – 50	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	51 – 52	LumenalSequence analysis	2
Transmembraneⁱ	53 – 73	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	74 – 86	CytoplasmicSequence analysisAdd BLAST	13
Transmembraneⁱ	87 – 107	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	108 – 112	LumenalSequence analysis	5
Transmembraneⁱ	113 – 133	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	134 – 139	CytoplasmicSequence analysis	6
Transmembraneⁱ	140 – 160	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	161 – 166	LumenalSequence analysis	6
Transmembraneⁱ	167 – 187	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	188 – 206	CytoplasmicSequence analysisAdd BLAST	19
Intramembraneⁱ	207 – 227	HelicalSequence analysisAdd BLAST	21
Topological domainⁱ	228 – 237	CytoplasmicSequence analysis	10

Keywords - Cellular componentⁱ

Endoplasmic reticulum, Membrane

Pathology & Biotechⁱ

Mutagenesis

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Mutagenesisⁱ	209	D → A: Abolishes calcium flux properties. 1 Publication		1
Mutagenesisⁱ	213	D → A: Abolishes calcium flux properties. 1 Publication		1

Organism-specific databases

DisGeNET More...DisGeNETⁱ	7009
Open Targets More...OpenTargetsⁱ	ENSG00000139644
PharmGKBⁱ	PA36440

Polymorphism and mutation databases

BioMutaⁱ	TMBIM6
DMDMⁱ	20981681

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000179078	1 – 237	Bax inhibitor 1Add BLAST		237

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Cross-linkⁱ	7	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)

Keywords - PTMⁱ

Isopeptide bond, Ubl conjugation

Proteomic databases

EPDⁱ	P55061
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P55061
PaxDbⁱ	P55061
PeptideAtlas More...PeptideAtlasⁱ	P55061
PRIDEⁱ	P55061
ProteomicsDBⁱ	56774
TopDownProteomicsⁱ	P55061-1 [P55061-1]

PTM databases

iPTMnetⁱ	P55061
PhosphoSitePlusⁱ	P55061

Expressionⁱ

Tissue specificityⁱ

Highly abundant in testis.1 Publication

Gene expression databases

Bgeeⁱ	ENSG00000139644 Expressed in 237 organ(s), highest expression level in cortex of kidney
CleanExⁱ	HS_TMBIM6
ExpressionAtlasⁱ	P55061 baseline and differential
Genevisibleⁱ	P55061 HS

Organism-specific databases

Human Protein Atlas More...HPAⁱ	HPA017378

HPAⁱ

HPA017378

Interactionⁱ

Subunit structureⁱ

Interacts with BCL2 and BCL2L1.1 Publication

GO - Molecular functionⁱ

enzyme binding
Source: ParkinsonsUK-UCL
Inferred from physical interactionⁱ
- 19328063
ubiquitin protein ligase binding
Source: ParkinsonsUK-UCL
Inferred from physical interactionⁱ
- 21068390

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	112868, 30 interactors
IntActⁱ	P55061, 53 interactors
Molecular INTeraction database More...MINTⁱ	P55061
STRINGⁱ	9606.ENSP00000389277

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P55061
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domainⁱ

The intra-membrane loop at the C-terminus acts as a calcium pore, mediating calcium leak from the ER into the cytosol.1 Publication

Sequence similaritiesⁱ

Belongs to the BI1 family.Curated

Keywords - Domainⁱ

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGⁱ	KOG1629 Eukaryota ENOG4111GCT LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00390000006722
HOGENOMⁱ	HOG000238748
HOVERGENⁱ	HBG001192
InParanoidⁱ	P55061
KEGG Orthology (KO) More...KOⁱ	K21889
OMAⁱ	PVRQHLK
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G0L75
PhylomeDBⁱ	P55061
TreeFamⁱ	TF323395

Family and domain databases

InterProⁱ	View protein in InterPro IPR006213 Bax_inhbtr1_CS IPR006214 Bax_inhibitor_1-related
PANTHERⁱ	PTHR23291 PTHR23291, 1 hit
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF01027 Bax1-I, 1 hit
PROSITEⁱ	View protein in PROSITE PS01243 BI1, 1 hit

Sequences (2+)ⁱ

Sequence statusⁱ: Complete.

This entry describes 2 isoformsⁱ produced by alternative splicing. Align Add to basket

This entry has 2 described isoforms and 13 potential isoforms that are computationally mapped.Show all Align All

Isoform 1 (identifier: P55061-1) [UniParc]FASTA Add to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNIFDRKINF DALLKFSHIT PSTQQHLKKV YASFALCMFV AAAGAYVHMV 
        60         70         80         90        100
THFIQAGLLS ALGSLILMIW LMATPHSHET EQKRLGLLAG FAFLTGVGLG 
       110        120        130        140        150
PALEFCIAVN PSILPTAFMG TAMIFTCFTL SALYARRRSY LFLGGILMSA 
       160        170        180        190        200
LSLLLLSSLG NVFFGSIWLF QANLYVGLVV MCGFVLFDTQ LIIEKAEHGD 
       210        220        230 
QDYIWHCIDL FLDFITVFRK LMMILAMNEK DKKKEKK

Length:237

Mass (Da):26,538

Last modified:May 15, 2002 - v2

Checksum:ⁱ6567E73A1AD6238E

GO

Isoform 2 (identifier: P55061-2) [UniParc]FASTA Add to basket

The sequence of this isoform differs from the canonical sequence as follows:
1-1: M → MSHSSVTREAPQLLSQRQRREVRGVWGWGCLPGPRGGPALFGLVTFGQSGDCCTDSGTM

« Hide

        10         20         30         40         50
MSHSSVTREA PQLLSQRQRR EVRGVWGWGC LPGPRGGPAL FGLVTFGQSG 
        60         70         80         90        100
DCCTDSGTMN IFDRKINFDA LLKFSHITPS TQQHLKKVYA SFALCMFVAA 
       110        120        130        140        150
AGAYVHMVTH FIQAGLLSAL GSLILMIWLM ATPHSHETEQ KRLGLLAGFA 
       160        170        180        190        200
FLTGVGLGPA LEFCIAVNPS ILPTAFMGTA MIFTCFTLSA LYARRRSYLF 
       210        220        230        240        250
LGGILMSALS LLLLSSLGNV FFGSIWLFQA NLYVGLVVMC GFVLFDTQLI 
       260        270        280        290 
IEKAEHGDQD YIWHCIDLFL DFITVFRKLM MILAMNEKDK KKEKK

Note: No experimental confirmation available.

Show »

Length:295

Mass (Da):32,711

Checksum:ⁱ7C3E89A2DBE8373E

GO

Computationally mapped potential isoform sequencesⁱ

There are 13 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

	Entry	Entry name	Protein names	Gene names	Length	Annotation

	F8VQQ5	F8VQQ5_HUMAN	Bax inhibitor 1 Bax inhibitor 1	TMBIM6	130	Annotation score:
	F8VSI7	F8VSI7_HUMAN	Bax inhibitor 1 Bax inhibitor 1	TMBIM6	138	Annotation score:
	F8VVJ4	F8VVJ4_HUMAN	Bax inhibitor 1 Bax inhibitor 1	TMBIM6	145	Annotation score:
	F8VR05	F8VR05_HUMAN	Bax inhibitor 1 Bax inhibitor 1	TMBIM6	113	Annotation score:
	F8W086	F8W086_HUMAN	Bax inhibitor 1 Bax inhibitor 1	TMBIM6	108	Annotation score:
	F8VPI1	F8VPI1_HUMAN	Bax inhibitor 1 Bax inhibitor 1	TMBIM6	89	Annotation score:
	F8W201	F8W201_HUMAN	Bax inhibitor 1 Bax inhibitor 1	TMBIM6	95	Annotation score:
	F8W1V3	F8W1V3_HUMAN	Bax inhibitor 1 Bax inhibitor 1	TMBIM6	200	Annotation score:
	F8VQW0	F8VQW0_HUMAN	Bax inhibitor 1 Bax inhibitor 1	TMBIM6	41	Annotation score:
	F8VX73	F8VX73_HUMAN	Bax inhibitor 1 Bax inhibitor 1	TMBIM6	44	Annotation score:
There are more potential isoformsShow all

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	118	F → L in AAU29521 (Ref. 2) Curated	1
Sequence conflictⁱ	169	L → P in CAA53472 (PubMed:8530040).Curated	1
Sequence conflictⁱ	187	F → V in CAA53472 (PubMed:8530040).Curated	1

Alternative sequence

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Alternative sequenceⁱVSP_055119	1	M → MSHSSVTREAPQLLSQRQRR EVRGVWGWGCLPGPRGGPAL FGLVTFGQSGDCCTDSGTM in isoform 2. 1 Publication		1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X75861 mRNA Translation: CAA53472.1 AF033095 mRNA Translation: AAB87479.1 AY736129 mRNA Translation: AAU29521.1 AK312238 mRNA Translation: BAG35171.1 AC020612 Genomic DNA No translation available. AC084037 Genomic DNA No translation available. AC131157 Genomic DNA No translation available. CH471111 Genomic DNA Translation: EAW58089.1 BC000916 mRNA Translation: AAH00916.1 BC036203 mRNA Translation: AAH36203.2
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS31797.1 [P55061-1] CCDS44875.1 [P55061-2]
PIRⁱ	I38334
NCBI Reference Sequences More...RefSeqⁱ	NP_001092046.1, NM_001098576.1 [P55061-2] NP_003208.2, NM_003217.2 [P55061-1] XP_005269183.1, XM_005269126.3 [P55061-2]
UniGeneⁱ	Hs.743965

Genome annotation databases

Ensemblⁱ	ENST00000267115; ENSP00000267115; ENSG00000139644 [P55061-1] ENST00000395006; ENSP00000378454; ENSG00000139644 [P55061-1] ENST00000423828; ENSP00000389277; ENSG00000139644 [P55061-2] ENST00000549385; ENSP00000448036; ENSG00000139644 [P55061-1] ENST00000552370; ENSP00000450158; ENSG00000139644 [P55061-1] ENST00000552699; ENSP00000446734; ENSG00000139644 [P55061-2]
GeneIDⁱ	7009
KEGGⁱ	hsa:7009
UCSC genome browser More...UCSCⁱ	uc001rux.3 human [P55061-1]

Keywords - Coding sequence diversityⁱ

Alternative splicing

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P55061	Bax inhibitor 1		HUMAN		200	UniRef100_P55061
Isoform 2 of Bax inhibitor 1		HUMAN		295
Testis enhanced gene transcript (BAX inhibitor 1), isoform CRA_a		HUMAN		237

Protein	Similar proteins		Species	Score	Length	Source
P55061	Bax inhibitor 1		PONAB		237	UniRef90_P55061
Bax inhibitor 1		HUMAN		200
Uncharacterized protein		NOMLE		298
Transmembrane BAX inhibitor motif containing 6		GORGO		295
TMBIM6 isoform 7		PANTR		200
+48

Protein	Similar proteins		Species	Score	Length	Source
P55061	Bax inhibitor 1		PONAB		237	UniRef50_P55061
Bax inhibitor 1		MOUSE		237
Bax inhibitor 1		PIG		237
Bax inhibitor 1		RAT		237
Probable Bax inhibitor 1		PAROL		237
+245

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	X75861 mRNA Translation: CAA53472.1 AF033095 mRNA Translation: AAB87479.1 AY736129 mRNA Translation: AAU29521.1 AK312238 mRNA Translation: BAG35171.1 AC020612 Genomic DNA No translation available. AC084037 Genomic DNA No translation available. AC131157 Genomic DNA No translation available. CH471111 Genomic DNA Translation: EAW58089.1 BC000916 mRNA Translation: AAH00916.1 BC036203 mRNA Translation: AAH36203.2
CCDSⁱ	CCDS31797.1 [P55061-1] CCDS44875.1 [P55061-2]
PIRⁱ	I38334
RefSeqⁱ	NP_001092046.1, NM_001098576.1 [P55061-2] NP_003208.2, NM_003217.2 [P55061-1] XP_005269183.1, XM_005269126.3 [P55061-2]
UniGeneⁱ	Hs.743965

3D structure databases

ProteinModelPortalⁱ	P55061
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	112868, 30 interactors
IntActⁱ	P55061, 53 interactors
MINTⁱ	P55061
STRINGⁱ	9606.ENSP00000389277

Protein family/group databases

TCDBⁱ	1.A.14.1.1 the calcium transporter a (cata) (formerly the testis-enhanced gene transfer (tegt) family

TCDBⁱ

1.A.14.1.1 the calcium transporter a (cata) (formerly the testis-enhanced gene transfer (tegt) family

PTM databases

iPTMnetⁱ	P55061
PhosphoSitePlusⁱ	P55061

Polymorphism and mutation databases

BioMutaⁱ	TMBIM6
DMDMⁱ	20981681

Proteomic databases

EPDⁱ	P55061
MaxQBⁱ	P55061
PaxDbⁱ	P55061
PeptideAtlasⁱ	P55061
PRIDEⁱ	P55061
ProteomicsDBⁱ	56774
TopDownProteomicsⁱ	P55061-1 [P55061-1]

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENST00000267115; ENSP00000267115; ENSG00000139644 [P55061-1] ENST00000395006; ENSP00000378454; ENSG00000139644 [P55061-1] ENST00000423828; ENSP00000389277; ENSG00000139644 [P55061-2] ENST00000549385; ENSP00000448036; ENSG00000139644 [P55061-1] ENST00000552370; ENSP00000450158; ENSG00000139644 [P55061-1] ENST00000552699; ENSP00000446734; ENSG00000139644 [P55061-2]
GeneIDⁱ	7009
KEGGⁱ	hsa:7009
UCSCⁱ	uc001rux.3 human [P55061-1]

Organism-specific databases

CTDⁱ	7009
DisGeNETⁱ	7009
EuPathDBⁱ	HostDB:ENSG00000139644.12
GeneCardsⁱ	TMBIM6
HGNCⁱ	HGNC:11723 TMBIM6
HPAⁱ	HPA017378
MIMⁱ	600748 gene
neXtProtⁱ	NX_P55061
OpenTargetsⁱ	ENSG00000139644
PharmGKBⁱ	PA36440
GenAtlas: human gene database More...GenAtlasⁱ	Search...

Phylogenomic databases

eggNOGⁱ	KOG1629 Eukaryota ENOG4111GCT LUCA
GeneTreeⁱ	ENSGT00390000006722
HOGENOMⁱ	HOG000238748
HOVERGENⁱ	HBG001192
InParanoidⁱ	P55061
KOⁱ	K21889
OMAⁱ	PVRQHLK
OrthoDBⁱ	EOG091G0L75
PhylomeDBⁱ	P55061
TreeFamⁱ	TF323395

Miscellaneous databases

ChiTaRSⁱ	TMBIM6 human
GeneWikiⁱ	TEGT
GenomeRNAiⁱ	7009
Protein Ontology More...PROⁱ	PR:P55061
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSG00000139644 Expressed in 237 organ(s), highest expression level in cortex of kidney
CleanExⁱ	HS_TMBIM6
ExpressionAtlasⁱ	P55061 baseline and differential
Genevisibleⁱ	P55061 HS

Family and domain databases

InterProⁱ	View protein in InterPro IPR006213 Bax_inhbtr1_CS IPR006214 Bax_inhibitor_1-related
PANTHERⁱ	PTHR23291 PTHR23291, 1 hit
Pfamⁱ	View protein in Pfam PF01027 Bax1-I, 1 hit
PROSITEⁱ	View protein in PROSITE PS01243 BI1, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	BI1_HUMAN
Accessionⁱ	P55061Primary (citable) accession number: P55061 Secondary accession number(s): B2R5M4 , F8W034, O14938, Q643A7, Q96J50
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	October 1, 1996
	Last sequence update:	May 15, 2002
	Last modified:	September 12, 2018
	This is version 161 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program
Disclaimer	Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
Uncharacterized protein families (UPF)
List of uncharacterized protein family (UPF) entries
Human chromosome 12
Human chromosome 12: entries, gene names and cross-references to MIM
MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P55061 (BI1_HUMAN)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Bax inhibitor 1

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Protein family/group databases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Endoplasmic reticulum

Endoplasmic reticulum

Mitochondrion

Nucleus

Plasma Membrane

Other locations

Topology

Keywords - Cellular componenti

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Organism-specific databases

Polymorphism and mutation databases

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Organism-specific databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Phylogenomic databases

Family and domain databases

Experimental Info

Alternative sequence

Sequence databases

Genome annotation databases

Keywords - Coding sequence diversityi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

Protein family/group databases

PTM databases

Polymorphism and mutation databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

Pathology & Biotechⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Keywords - Domainⁱ

Keywords - Coding sequence diversityⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ