Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phospholipid transfer protein

Gene

PLTP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Facilitates the transfer of a spectrum of different lipid molecules, including diacylglycerol, phosphatidic acid, sphingomyelin, phosphatidylcholine, phosphatidylglycerol, cerebroside and phosphatidyl ethanolamine. Essential for the transfer of excess surface lipids from triglyceride-rich lipoproteins to HDL, thereby facilitating the formation of smaller lipoprotein remnants, contributing to the formation of LDL, and assisting in the maturation of HDL particles. PLTP also plays a key role in the uptake of cholesterol from peripheral cells and tissues that is subsequently transported to the liver for degradation and excretion. Two distinct forms of PLTP exist in plasma: an active form that can transfer PC from phospholipid vesicles to high-density lipoproteins (HDL), and an inactive form that lacks this capability.

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processLipid transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-8964058 HDL remodeling
SignaLinkiP55058

Protein family/group databases

TCDBi1.C.40.1.4 the bactericidal permeability increasing protein (bpip) family

Chemistry databases

SwissLipidsiSLP:000000469

Names & Taxonomyi

Protein namesi
Recommended name:
Phospholipid transfer protein
Alternative name(s):
Lipid transfer protein II
Gene namesi
Name:PLTP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000100979.14
HGNCiHGNC:9093 PLTP
MIMi172425 gene
neXtProtiNX_P55058

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi5360
OpenTargetsiENSG00000100979
PharmGKBiPA273

Chemistry databases

ChEMBLiCHEMBL5962

Polymorphism and mutation databases

BioMutaiPLTP
DMDMi1709662

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 171 PublicationAdd BLAST17
ChainiPRO_000001716218 – 493Phospholipid transfer proteinAdd BLAST476

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi64N-linked (GlcNAc...) (complex) asparagine3 Publications1
Glycosylationi94N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi117N-linked (GlcNAc...) (complex) asparagine1
Glycosylationi143N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi146 ↔ 1851 Publication
Glycosylationi245N-linked (GlcNAc...) (complex) asparagine2 Publications1
Glycosylationi398N-linked (GlcNAc...) asparagine1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

EPDiP55058
MaxQBiP55058
PaxDbiP55058
PeptideAtlasiP55058
PRIDEiP55058
ProteomicsDBi56769
56770 [P55058-2]
TopDownProteomicsiP55058-1 [P55058-1]

PTM databases

GlyConnecti683
iPTMnetiP55058
PhosphoSitePlusiP55058
UniCarbKBiP55058

Miscellaneous databases

PMAP-CutDBiP55058

Expressioni

Tissue specificityi

Wide tissue distribution. Placenta > pancreas > lung > kidney > heart > liver > skeletal muscle > brain.

Gene expression databases

BgeeiENSG00000100979 Expressed in 218 organ(s), highest expression level in layer of synovial tissue
CleanExiHS_PLTP
GenevisibleiP55058 HS

Organism-specific databases

HPAiCAB032873

Interactioni

Protein-protein interaction databases

BioGridi111374, 36 interactors
IntActiP55058, 1 interactor
STRINGi9606.ENSP00000361508

Chemistry databases

BindingDBiP55058

Structurei

3D structure databases

ProteinModelPortaliP55058
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG4160 Eukaryota
ENOG410Z88E LUCA
GeneTreeiENSGT00730000110583
HOGENOMiHOG000231006
HOVERGENiHBG103156
InParanoidiP55058
KOiK08761
OMAiPVQLSSM
OrthoDBiEOG091G058L
PhylomeDBiP55058
TreeFamiTF315617

Family and domain databases

InterProiView protein in InterPro
IPR017943 Bactericidal_perm-incr_a/b_dom
IPR030675 BPI/LBP
IPR032942 BPI/LBP/Plunc
IPR001124 Lipid-bd_serum_glycop_C
IPR017954 Lipid-bd_serum_glycop_CS
IPR017942 Lipid-bd_serum_glycop_N
IPR030179 PLTP
PANTHERiPTHR10504 PTHR10504, 1 hit
PTHR10504:SF16 PTHR10504:SF16, 1 hit
PfamiView protein in Pfam
PF01273 LBP_BPI_CETP, 1 hit
PF02886 LBP_BPI_CETP_C, 1 hit
PIRSFiPIRSF002417 Lipid_binding_protein, 1 hit
SMARTiView protein in SMART
SM00328 BPI1, 1 hit
SM00329 BPI2, 1 hit
SUPFAMiSSF55394 SSF55394, 2 hits
PROSITEiView protein in PROSITE
PS00400 LBP_BPI_CETP, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P55058-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALFGALFLA LLAGAHAEFP GCKIRVTSKA LELVKQEGLR FLEQELETIT
60 70 80 90 100
IPDLRGKEGH FYYNISEVKV TELQLTSSEL DFQPQQELML QITNASLGLR
110 120 130 140 150
FRRQLLYWFF YDGGYINASA EGVSIRTGLE LSRDPAGRMK VSNVSCQASV
160 170 180 190 200
SRMHAAFGGT FKKVYDFLST FITSGMRFLL NQQICPVLYH AGTVLLNSLL
210 220 230 240 250
DTVPVRSSVD ELVGIDYSLM KDPVASTSNL DMDFRGAFFP LTERNWSLPN
260 270 280 290 300
RAVEPQLQEE ERMVYVAFSE FFFDSAMESY FRAGALQLLL VGDKVPHDLD
310 320 330 340 350
MLLRATYFGS IVLLSPAVID SPLKLELRVL APPRCTIKPS GTTISVTASV
360 370 380 390 400
TIALVPPDQP EVQLSSMTMD ARLSAKMALR GKALRTQLDL RRFRIYSNHS
410 420 430 440 450
ALESLALIPL QAPLKTMLQI GVMPMLNERT WRGVQIPLPE GINFVHEVVT
460 470 480 490
NHAGFLTIGA DLHFAKGLRE VIEKNRPADV RASTAPTPST AAV
Length:493
Mass (Da):54,739
Last modified:October 1, 1996 - v1
Checksum:iC6E4852F18E12317
GO
Isoform 2 (identifier: P55058-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     110-162: FYDGGYINASAEGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFK → L

Show »
Length:441
Mass (Da):49,272
Checksum:i4D7435F89F79ABAA
GO
Isoform 3 (identifier: P55058-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-162: Missing.

Note: No experimental confirmation available.
Show »
Length:398
Mass (Da):44,135
Checksum:i6D2141C6899E98CB
GO
Isoform 4 (identifier: P55058-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-88: Missing.

Note: No experimental confirmation available.
Show »
Length:405
Mass (Da):44,847
Checksum:iB916DC8F704401C0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti18E → V in AAH19847 (PubMed:15489334).Curated1
Sequence conflicti18E → V in AAH19898 (PubMed:15489334).Curated1
Sequence conflicti331A → V in BAG61226 (PubMed:14702039).Curated1
Sequence conflicti375A → S in BAG56696 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_018879124S → Y1 PublicationCorresponds to variant dbSNP:rs11569636Ensembl.1
Natural variantiVAR_017020282R → Q1 PublicationCorresponds to variant dbSNP:rs56126980Ensembl.1
Natural variantiVAR_017021372R → H1 PublicationCorresponds to variant dbSNP:rs144710772Ensembl.1
Natural variantiVAR_017022380R → W1 PublicationCorresponds to variant dbSNP:rs6065903Ensembl.1
Natural variantiVAR_018880425M → I1 PublicationCorresponds to variant dbSNP:rs11569675Ensembl.1
Natural variantiVAR_012073444F → L. Corresponds to variant dbSNP:rs1804161Ensembl.1
Natural variantiVAR_012074487T → K. Corresponds to variant dbSNP:rs1056929Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0540281 – 88Missing in isoform 4. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_04587768 – 162Missing in isoform 3. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_003050110 – 162FYDGG…GGTFK → L in isoform 2. 2 PublicationsAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L26232 mRNA Translation: AAA36443.1
AB076694 mRNA Translation: BAB79630.1
AL008726 Genomic DNA Translation: CAA15499.1
AK289371 mRNA Translation: BAF82060.1
AK293150 mRNA Translation: BAG56696.1
AK299181 mRNA Translation: BAG61226.1
AL008726 Genomic DNA Translation: CAC36020.1
AY509570 Genomic DNA Translation: AAR87775.1
CH471077 Genomic DNA Translation: EAW75782.1
CH471077 Genomic DNA Translation: EAW75781.1
CH471077 Genomic DNA Translation: EAW75783.1
CH471077 Genomic DNA Translation: EAW75785.1
CH471077 Genomic DNA Translation: EAW75787.1
BC005045 mRNA Translation: AAH05045.1
BC019847 mRNA Translation: AAH19847.1
BC019898 mRNA Translation: AAH19898.1
CCDSiCCDS13386.1 [P55058-1]
CCDS13387.1 [P55058-2]
CCDS56196.1 [P55058-4]
CCDS56197.1 [P55058-3]
PIRiA53533
RefSeqiNP_001229849.1, NM_001242920.1 [P55058-3]
NP_001229850.1, NM_001242921.1 [P55058-4]
NP_006218.1, NM_006227.3 [P55058-1]
NP_872617.1, NM_182676.2 [P55058-2]
UniGeneiHs.439312

Genome annotation databases

EnsembliENST00000354050; ENSP00000335290; ENSG00000100979 [P55058-2]
ENST00000372420; ENSP00000361497; ENSG00000100979 [P55058-4]
ENST00000372431; ENSP00000361508; ENSG00000100979 [P55058-1]
ENST00000420868; ENSP00000411671; ENSG00000100979 [P55058-3]
ENST00000477313; ENSP00000417138; ENSG00000100979 [P55058-1]
GeneIDi5360
KEGGihsa:5360
UCSCiuc002xql.3 human [P55058-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L26232 mRNA Translation: AAA36443.1
AB076694 mRNA Translation: BAB79630.1
AL008726 Genomic DNA Translation: CAA15499.1
AK289371 mRNA Translation: BAF82060.1
AK293150 mRNA Translation: BAG56696.1
AK299181 mRNA Translation: BAG61226.1
AL008726 Genomic DNA Translation: CAC36020.1
AY509570 Genomic DNA Translation: AAR87775.1
CH471077 Genomic DNA Translation: EAW75782.1
CH471077 Genomic DNA Translation: EAW75781.1
CH471077 Genomic DNA Translation: EAW75783.1
CH471077 Genomic DNA Translation: EAW75785.1
CH471077 Genomic DNA Translation: EAW75787.1
BC005045 mRNA Translation: AAH05045.1
BC019847 mRNA Translation: AAH19847.1
BC019898 mRNA Translation: AAH19898.1
CCDSiCCDS13386.1 [P55058-1]
CCDS13387.1 [P55058-2]
CCDS56196.1 [P55058-4]
CCDS56197.1 [P55058-3]
PIRiA53533
RefSeqiNP_001229849.1, NM_001242920.1 [P55058-3]
NP_001229850.1, NM_001242921.1 [P55058-4]
NP_006218.1, NM_006227.3 [P55058-1]
NP_872617.1, NM_182676.2 [P55058-2]
UniGeneiHs.439312

3D structure databases

ProteinModelPortaliP55058
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111374, 36 interactors
IntActiP55058, 1 interactor
STRINGi9606.ENSP00000361508

Chemistry databases

BindingDBiP55058
ChEMBLiCHEMBL5962
SwissLipidsiSLP:000000469

Protein family/group databases

TCDBi1.C.40.1.4 the bactericidal permeability increasing protein (bpip) family

PTM databases

GlyConnecti683
iPTMnetiP55058
PhosphoSitePlusiP55058
UniCarbKBiP55058

Polymorphism and mutation databases

BioMutaiPLTP
DMDMi1709662

Proteomic databases

EPDiP55058
MaxQBiP55058
PaxDbiP55058
PeptideAtlasiP55058
PRIDEiP55058
ProteomicsDBi56769
56770 [P55058-2]
TopDownProteomicsiP55058-1 [P55058-1]

Protocols and materials databases

DNASUi5360
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000354050; ENSP00000335290; ENSG00000100979 [P55058-2]
ENST00000372420; ENSP00000361497; ENSG00000100979 [P55058-4]
ENST00000372431; ENSP00000361508; ENSG00000100979 [P55058-1]
ENST00000420868; ENSP00000411671; ENSG00000100979 [P55058-3]
ENST00000477313; ENSP00000417138; ENSG00000100979 [P55058-1]
GeneIDi5360
KEGGihsa:5360
UCSCiuc002xql.3 human [P55058-1]

Organism-specific databases

CTDi5360
DisGeNETi5360
EuPathDBiHostDB:ENSG00000100979.14
GeneCardsiPLTP
HGNCiHGNC:9093 PLTP
HPAiCAB032873
MIMi172425 gene
neXtProtiNX_P55058
OpenTargetsiENSG00000100979
PharmGKBiPA273
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4160 Eukaryota
ENOG410Z88E LUCA
GeneTreeiENSGT00730000110583
HOGENOMiHOG000231006
HOVERGENiHBG103156
InParanoidiP55058
KOiK08761
OMAiPVQLSSM
OrthoDBiEOG091G058L
PhylomeDBiP55058
TreeFamiTF315617

Enzyme and pathway databases

ReactomeiR-HSA-8964058 HDL remodeling
SignaLinkiP55058

Miscellaneous databases

GeneWikiiPhospholipid_transfer_protein
GenomeRNAii5360
PMAP-CutDBiP55058
PROiPR:P55058
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000100979 Expressed in 218 organ(s), highest expression level in layer of synovial tissue
CleanExiHS_PLTP
GenevisibleiP55058 HS

Family and domain databases

InterProiView protein in InterPro
IPR017943 Bactericidal_perm-incr_a/b_dom
IPR030675 BPI/LBP
IPR032942 BPI/LBP/Plunc
IPR001124 Lipid-bd_serum_glycop_C
IPR017954 Lipid-bd_serum_glycop_CS
IPR017942 Lipid-bd_serum_glycop_N
IPR030179 PLTP
PANTHERiPTHR10504 PTHR10504, 1 hit
PTHR10504:SF16 PTHR10504:SF16, 1 hit
PfamiView protein in Pfam
PF01273 LBP_BPI_CETP, 1 hit
PF02886 LBP_BPI_CETP_C, 1 hit
PIRSFiPIRSF002417 Lipid_binding_protein, 1 hit
SMARTiView protein in SMART
SM00328 BPI1, 1 hit
SM00329 BPI2, 1 hit
SUPFAMiSSF55394 SSF55394, 2 hits
PROSITEiView protein in PROSITE
PS00400 LBP_BPI_CETP, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPLTP_HUMAN
AccessioniPrimary (citable) accession number: P55058
Secondary accession number(s): A8K006
, B4DDD5, B4DRB4, E1P5N8, E7EV16, Q8WTT1, Q9BR07, Q9BSH8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: November 7, 2018
This is version 174 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again