Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 182 (16 Oct 2019)
Sequence version 1 (01 Oct 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Phospholipid transfer protein

Gene

PLTP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Facilitates the transfer of a spectrum of different lipid molecules, including diacylglycerol, phosphatidic acid, sphingomyelin, phosphatidylcholine, phosphatidylglycerol, cerebroside and phosphatidyl ethanolamine. Essential for the transfer of excess surface lipids from triglyceride-rich lipoproteins to HDL, thereby facilitating the formation of smaller lipoprotein remnants, contributing to the formation of LDL, and assisting in the maturation of HDL particles. PLTP also plays a key role in the uptake of cholesterol from peripheral cells and tissues that is subsequently transported to the liver for degradation and excretion. Two distinct forms of PLTP exist in plasma: an active form that can transfer PC from phospholipid vesicles to high-density lipoproteins (HDL), and an inactive form that lacks this capability.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processLipid transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8964058 HDL remodeling

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P55058

Protein family/group databases

Transport Classification Database

More...
TCDBi
1.C.40.1.4 the bactericidal permeability increasing protein (bpip) family

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000000469

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Phospholipid transfer protein
Alternative name(s):
Lipid transfer protein II
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PLTP
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 20

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:9093 PLTP

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
172425 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P55058

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
5360

Open Targets

More...
OpenTargetsi
ENSG00000100979

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA273

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P55058

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5962

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PLTP

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1709662

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 171 PublicationAdd BLAST17
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001716218 – 493Phospholipid transfer proteinAdd BLAST476

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi64N-linked (GlcNAc...) (complex) asparagine3 Publications1
Glycosylationi94N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi117N-linked (GlcNAc...) (complex) asparagine1
Glycosylationi143N-linked (GlcNAc...) asparagine2 Publications1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi146 ↔ 1851 Publication
Glycosylationi245N-linked (GlcNAc...) (complex) asparagine2 Publications1
Glycosylationi398N-linked (GlcNAc...) asparagine1 Publication1

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-1321
non-CPTAC-1145

Encyclopedia of Proteome Dynamics

More...
EPDi
P55058

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P55058

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P55058

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P55058

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P55058

PeptideAtlas

More...
PeptideAtlasi
P55058

PRoteomics IDEntifications database

More...
PRIDEi
P55058

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
18550
56769 [P55058-1]
56770 [P55058-2]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P55058-1 [P55058-1]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
683

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P55058

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P55058

UniCarbKB; an annotated and curated database of glycan structures

More...
UniCarbKBi
P55058

Miscellaneous databases

CutDB - Proteolytic event database

More...
PMAP-CutDBi
P55058

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Wide tissue distribution. Placenta > pancreas > lung > kidney > heart > liver > skeletal muscle > brain.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000100979 Expressed in 218 organ(s), highest expression level in layer of synovial tissue

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P55058 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB032873

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111374, 37 interactors

Protein interaction database and analysis system

More...
IntActi
P55058, 22 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000417138

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P55058

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4160 Eukaryota
ENOG410Z88E LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182632

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231006

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P55058

KEGG Orthology (KO)

More...
KOi
K08761

Identification of Orthologs from Complete Genome Data

More...
OMAi
RILYWFF

Database of Orthologous Groups

More...
OrthoDBi
1460460at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P55058

TreeFam database of animal gene trees

More...
TreeFami
TF315617

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR017943 Bactericidal_perm-incr_a/b_dom
IPR030675 BPI/LBP
IPR032942 BPI/LBP/Plunc
IPR001124 Lipid-bd_serum_glycop_C
IPR017954 Lipid-bd_serum_glycop_CS
IPR017942 Lipid-bd_serum_glycop_N
IPR030179 PLTP

The PANTHER Classification System

More...
PANTHERi
PTHR10504 PTHR10504, 1 hit
PTHR10504:SF16 PTHR10504:SF16, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01273 LBP_BPI_CETP, 1 hit
PF02886 LBP_BPI_CETP_C, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF002417 Lipid_binding_protein, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00328 BPI1, 1 hit
SM00329 BPI2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55394 SSF55394, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00400 LBP_BPI_CETP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P55058-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MALFGALFLA LLAGAHAEFP GCKIRVTSKA LELVKQEGLR FLEQELETIT
60 70 80 90 100
IPDLRGKEGH FYYNISEVKV TELQLTSSEL DFQPQQELML QITNASLGLR
110 120 130 140 150
FRRQLLYWFF YDGGYINASA EGVSIRTGLE LSRDPAGRMK VSNVSCQASV
160 170 180 190 200
SRMHAAFGGT FKKVYDFLST FITSGMRFLL NQQICPVLYH AGTVLLNSLL
210 220 230 240 250
DTVPVRSSVD ELVGIDYSLM KDPVASTSNL DMDFRGAFFP LTERNWSLPN
260 270 280 290 300
RAVEPQLQEE ERMVYVAFSE FFFDSAMESY FRAGALQLLL VGDKVPHDLD
310 320 330 340 350
MLLRATYFGS IVLLSPAVID SPLKLELRVL APPRCTIKPS GTTISVTASV
360 370 380 390 400
TIALVPPDQP EVQLSSMTMD ARLSAKMALR GKALRTQLDL RRFRIYSNHS
410 420 430 440 450
ALESLALIPL QAPLKTMLQI GVMPMLNERT WRGVQIPLPE GINFVHEVVT
460 470 480 490
NHAGFLTIGA DLHFAKGLRE VIEKNRPADV RASTAPTPST AAV
Length:493
Mass (Da):54,739
Last modified:October 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC6E4852F18E12317
GO
Isoform 2 (identifier: P55058-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     110-162: FYDGGYINASAEGVSIRTGLELSRDPAGRMKVSNVSCQASVSRMHAAFGGTFK → L

Show »
Length:441
Mass (Da):49,272
Checksum:i4D7435F89F79ABAA
GO
Isoform 3 (identifier: P55058-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-162: Missing.

Note: No experimental confirmation available.
Show »
Length:398
Mass (Da):44,135
Checksum:i6D2141C6899E98CB
GO
Isoform 4 (identifier: P55058-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-88: Missing.

Note: No experimental confirmation available.
Show »
Length:405
Mass (Da):44,847
Checksum:iB916DC8F704401C0
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti18E → V in AAH19847 (PubMed:15489334).Curated1
Sequence conflicti18E → V in AAH19898 (PubMed:15489334).Curated1
Sequence conflicti331A → V in BAG61226 (PubMed:14702039).Curated1
Sequence conflicti375A → S in BAG56696 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_018879124S → Y1 PublicationCorresponds to variant dbSNP:rs11569636Ensembl.1
Natural variantiVAR_017020282R → Q1 PublicationCorresponds to variant dbSNP:rs56126980Ensembl.1
Natural variantiVAR_017021372R → H1 PublicationCorresponds to variant dbSNP:rs144710772Ensembl.1
Natural variantiVAR_017022380R → W1 PublicationCorresponds to variant dbSNP:rs6065903Ensembl.1
Natural variantiVAR_018880425M → I1 PublicationCorresponds to variant dbSNP:rs11569675Ensembl.1
Natural variantiVAR_012073444F → L. Corresponds to variant dbSNP:rs1804161Ensembl.1
Natural variantiVAR_012074487T → K. Corresponds to variant dbSNP:rs1056929Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0540281 – 88Missing in isoform 4. 1 PublicationAdd BLAST88
Alternative sequenceiVSP_04587768 – 162Missing in isoform 3. 1 PublicationAdd BLAST95
Alternative sequenceiVSP_003050110 – 162FYDGG…GGTFK → L in isoform 2. 2 PublicationsAdd BLAST53

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L26232 mRNA Translation: AAA36443.1
AB076694 mRNA Translation: BAB79630.1
AL008726 Genomic DNA Translation: CAA15499.1
AK289371 mRNA Translation: BAF82060.1
AK293150 mRNA Translation: BAG56696.1
AK299181 mRNA Translation: BAG61226.1
AL008726 Genomic DNA Translation: CAC36020.1
AY509570 Genomic DNA Translation: AAR87775.1
CH471077 Genomic DNA Translation: EAW75782.1
CH471077 Genomic DNA Translation: EAW75781.1
CH471077 Genomic DNA Translation: EAW75783.1
CH471077 Genomic DNA Translation: EAW75785.1
CH471077 Genomic DNA Translation: EAW75787.1
BC005045 mRNA Translation: AAH05045.1
BC019847 mRNA Translation: AAH19847.1
BC019898 mRNA Translation: AAH19898.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS13386.1 [P55058-1]
CCDS13387.1 [P55058-2]
CCDS56196.1 [P55058-4]
CCDS56197.1 [P55058-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
A53533

NCBI Reference Sequences

More...
RefSeqi
NP_001229849.1, NM_001242920.1 [P55058-3]
NP_001229850.1, NM_001242921.1 [P55058-4]
NP_006218.1, NM_006227.3 [P55058-1]
NP_872617.1, NM_182676.2 [P55058-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000354050; ENSP00000335290; ENSG00000100979 [P55058-2]
ENST00000372420; ENSP00000361497; ENSG00000100979 [P55058-4]
ENST00000372431; ENSP00000361508; ENSG00000100979 [P55058-1]
ENST00000420868; ENSP00000411671; ENSG00000100979 [P55058-3]
ENST00000477313; ENSP00000417138; ENSG00000100979 [P55058-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5360

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5360

UCSC genome browser

More...
UCSCi
uc002xql.3 human [P55058-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L26232 mRNA Translation: AAA36443.1
AB076694 mRNA Translation: BAB79630.1
AL008726 Genomic DNA Translation: CAA15499.1
AK289371 mRNA Translation: BAF82060.1
AK293150 mRNA Translation: BAG56696.1
AK299181 mRNA Translation: BAG61226.1
AL008726 Genomic DNA Translation: CAC36020.1
AY509570 Genomic DNA Translation: AAR87775.1
CH471077 Genomic DNA Translation: EAW75782.1
CH471077 Genomic DNA Translation: EAW75781.1
CH471077 Genomic DNA Translation: EAW75783.1
CH471077 Genomic DNA Translation: EAW75785.1
CH471077 Genomic DNA Translation: EAW75787.1
BC005045 mRNA Translation: AAH05045.1
BC019847 mRNA Translation: AAH19847.1
BC019898 mRNA Translation: AAH19898.1
CCDSiCCDS13386.1 [P55058-1]
CCDS13387.1 [P55058-2]
CCDS56196.1 [P55058-4]
CCDS56197.1 [P55058-3]
PIRiA53533
RefSeqiNP_001229849.1, NM_001242920.1 [P55058-3]
NP_001229850.1, NM_001242921.1 [P55058-4]
NP_006218.1, NM_006227.3 [P55058-1]
NP_872617.1, NM_182676.2 [P55058-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi111374, 37 interactors
IntActiP55058, 22 interactors
STRINGi9606.ENSP00000417138

Chemistry databases

BindingDBiP55058
ChEMBLiCHEMBL5962
SwissLipidsiSLP:000000469

Protein family/group databases

TCDBi1.C.40.1.4 the bactericidal permeability increasing protein (bpip) family

PTM databases

GlyConnecti683
iPTMnetiP55058
PhosphoSitePlusiP55058
UniCarbKBiP55058

Polymorphism and mutation databases

BioMutaiPLTP
DMDMi1709662

Proteomic databases

CPTACiCPTAC-1321
non-CPTAC-1145
EPDiP55058
jPOSTiP55058
MassIVEiP55058
MaxQBiP55058
PaxDbiP55058
PeptideAtlasiP55058
PRIDEiP55058
ProteomicsDBi18550
56769 [P55058-1]
56770 [P55058-2]
TopDownProteomicsiP55058-1 [P55058-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5360

Genome annotation databases

EnsembliENST00000354050; ENSP00000335290; ENSG00000100979 [P55058-2]
ENST00000372420; ENSP00000361497; ENSG00000100979 [P55058-4]
ENST00000372431; ENSP00000361508; ENSG00000100979 [P55058-1]
ENST00000420868; ENSP00000411671; ENSG00000100979 [P55058-3]
ENST00000477313; ENSP00000417138; ENSG00000100979 [P55058-1]
GeneIDi5360
KEGGihsa:5360
UCSCiuc002xql.3 human [P55058-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5360
DisGeNETi5360

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PLTP
HGNCiHGNC:9093 PLTP
HPAiCAB032873
MIMi172425 gene
neXtProtiNX_P55058
OpenTargetsiENSG00000100979
PharmGKBiPA273

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4160 Eukaryota
ENOG410Z88E LUCA
GeneTreeiENSGT00950000182632
HOGENOMiHOG000231006
InParanoidiP55058
KOiK08761
OMAiRILYWFF
OrthoDBi1460460at2759
PhylomeDBiP55058
TreeFamiTF315617

Enzyme and pathway databases

ReactomeiR-HSA-8964058 HDL remodeling
SignaLinkiP55058

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PLTP human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Phospholipid_transfer_protein

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5360
PharosiP55058
PMAP-CutDBiP55058

Protein Ontology

More...
PROi
PR:P55058

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000100979 Expressed in 218 organ(s), highest expression level in layer of synovial tissue
GenevisibleiP55058 HS

Family and domain databases

InterProiView protein in InterPro
IPR017943 Bactericidal_perm-incr_a/b_dom
IPR030675 BPI/LBP
IPR032942 BPI/LBP/Plunc
IPR001124 Lipid-bd_serum_glycop_C
IPR017954 Lipid-bd_serum_glycop_CS
IPR017942 Lipid-bd_serum_glycop_N
IPR030179 PLTP
PANTHERiPTHR10504 PTHR10504, 1 hit
PTHR10504:SF16 PTHR10504:SF16, 1 hit
PfamiView protein in Pfam
PF01273 LBP_BPI_CETP, 1 hit
PF02886 LBP_BPI_CETP_C, 1 hit
PIRSFiPIRSF002417 Lipid_binding_protein, 1 hit
SMARTiView protein in SMART
SM00328 BPI1, 1 hit
SM00329 BPI2, 1 hit
SUPFAMiSSF55394 SSF55394, 2 hits
PROSITEiView protein in PROSITE
PS00400 LBP_BPI_CETP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPLTP_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P55058
Secondary accession number(s): A8K006
, B4DDD5, B4DRB4, E1P5N8, E7EV16, Q8WTT1, Q9BR07, Q9BSH8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: October 16, 2019
This is version 182 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again