Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 212 (16 Oct 2019)
Sequence version 2 (18 Oct 2001)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ephrin type-B receptor 4

Gene

EPHB4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor tyrosine kinase which binds promiscuously transmembrane ephrin-B family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Together with its cognate ligand/functional ligand EFNB2 it is involved in the regulation of cell adhesion and migration, and plays a central role in heart morphogenesis, angiogenesis and blood vessel remodeling and permeability. EPHB4-mediated forward signaling controls cellular repulsion and segregation from EFNB2-expressing cells.4 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei647ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei740Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi621 – 629ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Kinase, Receptor, Transferase, Tyrosine-protein kinase
Biological processAngiogenesis
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.10.1 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2682334 EPH-Ephrin signaling
R-HSA-3928662 EPHB-mediated forward signaling
R-HSA-3928664 Ephrin signaling
R-HSA-3928665 EPH-ephrin mediated repulsion of cells

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P54760

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P54760

Protein family/group databases

Transport Classification Database

More...
TCDBi
8.A.23.1.15 the basigin (basigin) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ephrin type-B receptor 4 (EC:2.7.10.1)
Alternative name(s):
Hepatoma transmembrane kinase
Tyrosine-protein kinase TYRO11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:EPHB4
Synonyms:HTK, MYK1, TYRO11
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:3395 EPHB4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600011 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P54760

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini16 – 539ExtracellularSequence analysisAdd BLAST524
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei540 – 560HelicalSequence analysisAdd BLAST21
Topological domaini561 – 987CytoplasmicSequence analysisAdd BLAST427

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Lymphatic malformation 7 (LMPHM7)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of primary lymphedema, a disease characterized by swelling of body parts due to developmental anomalies and functional defects of the lymphatic system. Patients with lymphedema may suffer from recurrent local infections. LMPHM7 is an autosomal dominant form with variable expressivity. Some individuals present with severe non-immune hydrops fetalis, which may cause perinatal demise or fully resolve after the neonatal period. Others present with no edema and have milder clinical features, such as atrial septal defect or varicose veins as adults.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_078063739R → Q in LMPHM7; loss of kinase activity. 1 PublicationCorresponds to variant dbSNP:rs1057519263EnsemblClinVar.1
Natural variantiVAR_078064782I → S in LMPHM7; loss of kinase activity. 1 PublicationCorresponds to variant dbSNP:rs1057519264EnsemblClinVar.1
Capillary malformation-arteriovenous malformation 2 (CMAVM2)4 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal dominant disorder characterized by multiple, round to oval or more irregularly shaped macules that are pinkish red in color and are randomly distributed across the body. These capillary malformations are associated with either arteriovenous malformation, arteriovenous fistula, or Parkes Weber syndrome.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_08168959E → K in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_08169074R → P in CMAVM2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs61735971Ensembl.1
Natural variantiVAR_081691107C → R in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081692115Missing in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081693130 – 987Missing in CMAVM2. 1 PublicationAdd BLAST858
Natural variantiVAR_081694161 – 162VK → L in CMAVM2; unknown pathological significance. 1 Publication2
Natural variantiVAR_081695187L → P in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081696244 – 987Missing in CMAVM2. 1 PublicationAdd BLAST744
Natural variantiVAR_081697268C → R in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081698352 – 987Missing in CMAVM2. 1 PublicationAdd BLAST636
Natural variantiVAR_081699375 – 987Missing in CMAVM2. 1 PublicationAdd BLAST613
Natural variantiVAR_081700431 – 987Missing in CMAVM2. 1 PublicationAdd BLAST557
Natural variantiVAR_081701469V → G in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081703516G → R in CMAVM2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs776305185Ensembl.1
Natural variantiVAR_081704520 – 987Missing in CMAVM2. 1 PublicationAdd BLAST468
Natural variantiVAR_081705596 – 987Missing in CMAVM2. 1 PublicationAdd BLAST392
Natural variantiVAR_081706650K → N in CMAVM2; highly decreased tyrosine phosphorylation; highly decreased interaction with RASA1. 1 Publication1
Natural variantiVAR_081707656R → W in CMAVM2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs745584371Ensembl.1
Natural variantiVAR_081708664E → K in CMAVM2; the mutant protein is not detected by Western blot; loss of localization to cell membrane. 1 Publication1
Natural variantiVAR_081709725A → T in CMAVM2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs1159930961Ensembl.1
Natural variantiVAR_081710739 – 987Missing in CMAVM2. 1 PublicationAdd BLAST249
Natural variantiVAR_081711745N → D in CMAVM2. 1 Publication1
Natural variantiVAR_081712789P → R in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081713789P → S in CMAVM2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs1417508111Ensembl.1
Natural variantiVAR_081714802D → G in CMAVM2. 1 PublicationCorresponds to variant dbSNP:rs776410552Ensembl.1
Natural variantiVAR_081715806 – 987Missing in CMAVM2. 1 PublicationAdd BLAST182
Natural variantiVAR_081716807G → R in CMAVM2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs1330628156Ensembl.1
Natural variantiVAR_081717820P → L in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081718820P → T in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081719838R → W in CMAVM2; the mutant protein is not detected by Western blot; loss of localization to cell membrane. 1 PublicationCorresponds to variant dbSNP:rs764827256Ensembl.1
Natural variantiVAR_081720845C → R in CMAVM2; the mutant protein is not detected by Western blot; loss of localization to cell membrane. 1 Publication1
Natural variantiVAR_081721856C → Y in CMAVM2. 1 Publication1
Natural variantiVAR_081722864R → W in CMAVM2; the mutant protein is not detected by Western blot; loss of localization to cell membrane. 1 PublicationCorresponds to variant dbSNP:rs769965440Ensembl.1
Natural variantiVAR_081723867F → L in CMAVM2; loss of tyrosine phosphorylation; loss of interaction with RASA1. 1 Publication1
Natural variantiVAR_081724870V → E in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081725874L → P in CMAVM2; unknown pathological significance. 1 Publication1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi95L → R: Reduces binding affinity for EFNB2. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
2050

MalaCards human disease database

More...
MalaCardsi
EPHB4
MIMi617300 phenotype
618196 phenotype

NIAGADS Genomics Database

More...
NIAGADSi
ENSG00000196411

Open Targets

More...
OpenTargetsi
ENSG00000196411

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA27827

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
P54760

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5147

Drug and drug target database

More...
DrugBanki
DB07256 3-({4-[(5-CHLORO-1,3-BENZODIOXOL-4-YL)AMINO]PYRIMIDIN-2-YL}AMINO)BENZAMIDE
DB07252 3-({4-[(5-chloro-1,3-benzodioxol-4-yl)amino]pyrimidin-2-yl}amino)benzenesulfonamide
DB01254 Dasatinib
DB12010 Fostamatinib
DB07251 N'-(3-CHLORO-4-METHOXY-PHENYL)-N-(3,4,5-TRIMETHOXYPHENYL)-1,3,5-TRIAZINE-2,4-DIAMINE
DB07250 N'-(5-CHLORO-1,3-BENZODIOXOL-4-YL)-N-(3,4,5- TRIMETHOXYPHENYL)PYRIMIDINE-2,4-DIAMINE
DB07253 N'-(5-chloro-1,3-benzodioxol-4-yl)-N-(3-methylsulfonylphenyl)pyrimidine-2,4-diamine
DB07255 N'-(5-CHLORO-1,3-BENZODIOXOL-4-YL)-N-(3-MORPHOLIN-4-YLPHENYL)PYRIMIDINE-2,4-DIAMINE
DB07249 N-(5-chloro-1,3-benzodioxol-4-yl)-6-methoxy-7-(3-piperidin-1-ylpropoxy)quinazolin-4-amine
DB07254 N-[3-[[4-[(5-CHLORO-1,3-BENZODIOXOL-4-YL)AMINO]PYRIMIDIN-2-YL]AMINO]PHENYL]METHANESULFONAMIDE
DB11973 Tesevatinib

DrugCentral

More...
DrugCentrali
P54760

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1833

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
EPHB4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
19860819

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 15Sequence analysisAdd BLAST15
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001683416 – 987Ephrin type-B receptor 4Add BLAST972

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi61 ↔ 184
Disulfide bondi97 ↔ 107
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi203N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi335N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi426N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei769PhosphoserineCombined sources1
Modified residuei770PhosphoserineCombined sources1
Modified residuei911PhosphoserineCombined sources1
Modified residuei943PhosphoserineCombined sources1
Modified residuei976PhosphothreonineCombined sources1
Modified residuei987PhosphotyrosineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated; autophosphorylation is stimulated by EFNB2.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

The CPTAC Assay portal

More...
CPTACi
CPTAC-2788

Encyclopedia of Proteome Dynamics

More...
EPDi
P54760

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P54760

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P54760

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P54760

PeptideAtlas

More...
PeptideAtlasi
P54760

PRoteomics IDEntifications database

More...
PRIDEi
P54760

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
56715 [P54760-1]

2D gel databases

DOSAC-COBS 2D-PAGE database

More...
DOSAC-COBS-2DPAGEi
P54760

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1214

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P54760

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P54760

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P54760

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Abundantly expressed in placenta but also detected in kidney, liver, lung, pancreas, skeletal muscle and heart. Expressed in primitive and myeloid, but not lymphoid, hematopoietic cells. Also observed in cell lines derived from liver, breast, colon, lung, melanocyte and cervix.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in fetal heart, lung, liver and to a lower extent in brain. Not expressed in adult brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000196411 Expressed in 231 organ(s), highest expression level in dorsal plus ventral thalamus

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P54760 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P54760 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB013537

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Heterotetramer upon binding of the ligand. The heterotetramer is composed of an ephrin dimer and a receptor dimer. Oligomerization is probably required to induce biological responses (By similarity).

Interacts with RASA1; the interaction depends on EPHB4 tyrosine-phosphorylation (PubMed:30578106).

By similarity1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
108364, 39 interactors

Protein interaction database and analysis system

More...
IntActi
P54760, 31 interactors

Molecular INTeraction database

More...
MINTi
P54760

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000350896

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P54760

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1987
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P54760

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P54760

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini17 – 202Eph LBDPROSITE-ProRule annotationAdd BLAST186
Domaini323 – 432Fibronectin type-III 1PROSITE-ProRule annotationAdd BLAST110
Domaini436 – 529Fibronectin type-III 2PROSITE-ProRule annotationAdd BLAST94
Domaini615 – 899Protein kinasePROSITE-ProRule annotationAdd BLAST285
Domaini907 – 971SAMPROSITE-ProRule annotationAdd BLAST65

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi985 – 987PDZ-bindingSequence analysis3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi184 – 320Cys-richAdd BLAST137

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0196 Eukaryota
COG0515 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160057

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000233856

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P54760

KEGG Orthology (KO)

More...
KOi
K05113

Identification of Orthologs from Complete Genome Data

More...
OMAi
RYCEKER

Database of Orthologous Groups

More...
OrthoDBi
1109019at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P54760

TreeFam database of animal gene trees

More...
TreeFami
TF315608

Family and domain databases

Conserved Domains Database

More...
CDDi
cd10474 EphR_LBD_B4, 1 hit
cd00063 FN3, 2 hits
cd09554 SAM_EPH-B4, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.150.50, 1 hit
2.60.120.260, 1 hit
2.60.40.10, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR037636 EPH-B4_SAM
IPR027936 Eph_TM
IPR034290 EphB4_rcpt_lig-bd
IPR001090 Ephrin_rcpt_lig-bd_dom
IPR003961 FN3_dom
IPR036116 FN3_sf
IPR008979 Galactose-bd-like_sf
IPR009030 Growth_fac_rcpt_cys_sf
IPR013783 Ig-like_fold
IPR011009 Kinase-like_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR001660 SAM
IPR013761 SAM/pointed_sf
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR011641 Tyr-kin_ephrin_A/B_rcpt-like
IPR008266 Tyr_kinase_AS
IPR020635 Tyr_kinase_cat_dom
IPR016257 Tyr_kinase_ephrin_rcpt
IPR001426 Tyr_kinase_rcpt_V_CS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14575 EphA2_TM, 1 hit
PF01404 Ephrin_lbd, 1 hit
PF07699 Ephrin_rec_like, 1 hit
PF00041 fn3, 2 hits
PF07714 Pkinase_Tyr, 1 hit
PF00536 SAM_1, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000666 TyrPK_ephrin_receptor, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00109 TYRKINASE

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00615 EPH_lbd, 1 hit
SM01411 Ephrin_rec_like, 1 hit
SM00060 FN3, 2 hits
SM00454 SAM, 1 hit
SM00219 TyrKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47769 SSF47769, 1 hit
SSF49265 SSF49265, 1 hit
SSF49785 SSF49785, 1 hit
SSF56112 SSF56112, 1 hit
SSF57184 SSF57184, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01186 EGF_2, 1 hit
PS51550 EPH_LBD, 1 hit
PS50853 FN3, 2 hits
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00109 PROTEIN_KINASE_TYR, 1 hit
PS00790 RECEPTOR_TYR_KIN_V_1, 1 hit
PS00791 RECEPTOR_TYR_KIN_V_2, 1 hit
PS50105 SAM_DOMAIN, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P54760-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELRVLLCWA SLAAALEETL LNTKLETADL KWVTFPQVDG QWEELSGLDE
60 70 80 90 100
EQHSVRTYEV CDVQRAPGQA HWLRTGWVPR RGAVHVYATL RFTMLECLSL
110 120 130 140 150
PRAGRSCKET FTVFYYESDA DTATALTPAW MENPYIKVDT VAAEHLTRKR
160 170 180 190 200
PGAEATGKVN VKTLRLGPLS KAGFYLAFQD QGACMALLSL HLFYKKCAQL
210 220 230 240 250
TVNLTRFPET VPRELVVPVA GSCVVDAVPA PGPSPSLYCR EDGQWAEQPV
260 270 280 290 300
TGCSCAPGFE AAEGNTKCRA CAQGTFKPLS GEGSCQPCPA NSHSNTIGSA
310 320 330 340 350
VCQCRVGYFR ARTDPRGAPC TTPPSAPRSV VSRLNGSSLH LEWSAPLESG
360 370 380 390 400
GREDLTYALR CRECRPGGSC APCGGDLTFD PGPRDLVEPW VVVRGLRPDF
410 420 430 440 450
TYTFEVTALN GVSSLATGPV PFEPVNVTTD REVPPAVSDI RVTRSSPSSL
460 470 480 490 500
SLAWAVPRAP SGAVLDYEVK YHEKGAEGPS SVRFLKTSEN RAELRGLKRG
510 520 530 540 550
ASYLVQVRAR SEAGYGPFGQ EHHSQTQLDE SEGWREQLAL IAGTAVVGVV
560 570 580 590 600
LVLVVIVVAV LCLRKQSNGR EAEYSDKHGQ YLIGHGTKVY IDPFTYEDPN
610 620 630 640 650
EAVREFAKEI DVSYVKIEEV IGAGEFGEVC RGRLKAPGKK ESCVAIKTLK
660 670 680 690 700
GGYTERQRRE FLSEASIMGQ FEHPNIIRLE GVVTNSMPVM ILTEFMENGA
710 720 730 740 750
LDSFLRLNDG QFTVIQLVGM LRGIASGMRY LAEMSYVHRD LAARNILVNS
760 770 780 790 800
NLVCKVSDFG LSRFLEENSS DPTYTSSLGG KIPIRWTAPE AIAFRKFTSA
810 820 830 840 850
SDAWSYGIVM WEVMSFGERP YWDMSNQDVI NAIEQDYRLP PPPDCPTSLH
860 870 880 890 900
QLMLDCWQKD RNARPRFPQV VSALDKMIRN PASLKIVARE NGGASHPLLD
910 920 930 940 950
QRQPHYSAFG SVGEWLRAIK MGRYEESFAA AGFGSFELVS QISAEDLLRI
960 970 980
GVTLAGHQKK ILASVQHMKS QAKPGTPGGT GGPAPQY
Length:987
Mass (Da):108,270
Last modified:October 18, 2001 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i11A004622F194706
GO
Isoform 2 (identifier: P54760-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     507-516: VRARSEAGYG → RARAGGSSWP
     517-987: Missing.

Show »
Length:516
Mass (Da):55,975
Checksum:i076696B61467596C
GO
Isoform 3 (identifier: P54760-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     270-306: ACAQGTFKPLSGEGSCQPCPANSHSNTIGSAVCQCRV → GRRGSQQRAVPEDVRKPGRAAGAEAGSQLPGAGTGAL
     307-987: Missing.

Show »
Length:306
Mass (Da):33,342
Checksum:iAAAB50A132494B86
GO
Isoform 4 (identifier: P54760-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     406-414: VTALNGVSS → YLLQCLTSG
     415-987: Missing.

Show »
Length:414
Mass (Da):45,195
Checksum:iA9596D1E38B18785
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q96L35Q96L35_HUMAN
EPH receptor B4, isoform CRA_b
EPHB4 hCG_20448
935Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti62D → E in AAA20598 (PubMed:8188704).Curated1
Sequence conflicti308Y → D in AAA20598 (PubMed:8188704).Curated1
Sequence conflicti464V → W in AAA20598 (PubMed:8188704).Curated1
Sequence conflicti926 – 927ES → AR in AAA20598 (PubMed:8188704).Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_08168959E → K in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_04218167P → L1 PublicationCorresponds to variant dbSNP:rs34653459Ensembl.1
Natural variantiVAR_08169074R → P in CMAVM2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs61735971Ensembl.1
Natural variantiVAR_081691107C → R in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_042182113V → I1 PublicationCorresponds to variant dbSNP:rs55866373Ensembl.1
Natural variantiVAR_081692115Missing in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081693130 – 987Missing in CMAVM2. 1 PublicationAdd BLAST858
Natural variantiVAR_081694161 – 162VK → L in CMAVM2; unknown pathological significance. 1 Publication2
Natural variantiVAR_071163162K → R1 PublicationCorresponds to variant dbSNP:rs17854760Ensembl.1
Natural variantiVAR_081695187L → P in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081696244 – 987Missing in CMAVM2. 1 PublicationAdd BLAST744
Natural variantiVAR_081697268C → R in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_042183346P → L in a metastatic melanoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs267601191Ensembl.1
Natural variantiVAR_081698352 – 987Missing in CMAVM2. 1 PublicationAdd BLAST636
Natural variantiVAR_042184371A → V1 PublicationCorresponds to variant dbSNP:rs55720981Ensembl.1
Natural variantiVAR_081699375 – 987Missing in CMAVM2. 1 PublicationAdd BLAST613
Natural variantiVAR_081700431 – 987Missing in CMAVM2. 1 PublicationAdd BLAST557
Natural variantiVAR_081701469V → G in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081702509A → G Probable polymorphism; does not affect tyrosine phosphorylation; does not affect interaction with RASA1. 1 PublicationCorresponds to variant dbSNP:rs146937374Ensembl.1
Natural variantiVAR_081703516G → R in CMAVM2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs776305185Ensembl.1
Natural variantiVAR_081704520 – 987Missing in CMAVM2. 1 PublicationAdd BLAST468
Natural variantiVAR_042185576D → E1 PublicationCorresponds to variant dbSNP:rs36050247Ensembl.1
Natural variantiVAR_081705596 – 987Missing in CMAVM2. 1 PublicationAdd BLAST392
Natural variantiVAR_081706650K → N in CMAVM2; highly decreased tyrosine phosphorylation; highly decreased interaction with RASA1. 1 Publication1
Natural variantiVAR_081707656R → W in CMAVM2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs745584371Ensembl.1
Natural variantiVAR_081708664E → K in CMAVM2; the mutant protein is not detected by Western blot; loss of localization to cell membrane. 1 Publication1
Natural variantiVAR_042186678R → H1 PublicationCorresponds to variant dbSNP:rs55692440Ensembl.1
Natural variantiVAR_081709725A → T in CMAVM2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs1159930961Ensembl.1
Natural variantiVAR_081710739 – 987Missing in CMAVM2. 1 PublicationAdd BLAST249
Natural variantiVAR_078063739R → Q in LMPHM7; loss of kinase activity. 1 PublicationCorresponds to variant dbSNP:rs1057519263EnsemblClinVar.1
Natural variantiVAR_081711745N → D in CMAVM2. 1 Publication1
Natural variantiVAR_078064782I → S in LMPHM7; loss of kinase activity. 1 PublicationCorresponds to variant dbSNP:rs1057519264EnsemblClinVar.1
Natural variantiVAR_081712789P → R in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081713789P → S in CMAVM2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs1417508111Ensembl.1
Natural variantiVAR_081714802D → G in CMAVM2. 1 PublicationCorresponds to variant dbSNP:rs776410552Ensembl.1
Natural variantiVAR_081715806 – 987Missing in CMAVM2. 1 PublicationAdd BLAST182
Natural variantiVAR_081716807G → R in CMAVM2; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs1330628156Ensembl.1
Natural variantiVAR_081717820P → L in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081718820P → T in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081719838R → W in CMAVM2; the mutant protein is not detected by Western blot; loss of localization to cell membrane. 1 PublicationCorresponds to variant dbSNP:rs764827256Ensembl.1
Natural variantiVAR_081720845C → R in CMAVM2; the mutant protein is not detected by Western blot; loss of localization to cell membrane. 1 Publication1
Natural variantiVAR_081721856C → Y in CMAVM2. 1 Publication1
Natural variantiVAR_081722864R → W in CMAVM2; the mutant protein is not detected by Western blot; loss of localization to cell membrane. 1 PublicationCorresponds to variant dbSNP:rs769965440Ensembl.1
Natural variantiVAR_081723867F → L in CMAVM2; loss of tyrosine phosphorylation; loss of interaction with RASA1. 1 Publication1
Natural variantiVAR_081724870V → E in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_081725874L → P in CMAVM2; unknown pathological significance. 1 Publication1
Natural variantiVAR_042187882A → T1 PublicationCorresponds to variant dbSNP:rs34918225Ensembl.1
Natural variantiVAR_042188889R → W in a gastric adenocarcinoma sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs762016655Ensembl.1
Natural variantiVAR_042189890E → D1 PublicationCorresponds to variant dbSNP:rs35638378Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_056020270 – 306ACAQG…CQCRV → GRRGSQQRAVPEDVRKPGRA AGAEAGSQLPGAGTGAL in isoform 3. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_056021307 – 987Missing in isoform 3. 1 PublicationAdd BLAST681
Alternative sequenceiVSP_056022406 – 414VTALNGVSS → YLLQCLTSG in isoform 4. 1 Publication9
Alternative sequenceiVSP_056023415 – 987Missing in isoform 4. 1 PublicationAdd BLAST573
Alternative sequenceiVSP_056024507 – 516VRARSEAGYG → RARAGGSSWP in isoform 2. 1 Publication10
Alternative sequenceiVSP_056025517 – 987Missing in isoform 2. 1 PublicationAdd BLAST471

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U07695 mRNA Translation: AAA20598.1
AF312032 Genomic DNA Translation: AAK21010.1
EU826608 mRNA Translation: ACF47644.1
EU826609 mRNA Translation: ACF47645.1
EU826610 mRNA Translation: ACF47646.1
BC004264 mRNA Translation: AAH04264.1
BC052804 mRNA Translation: AAH52804.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS5706.1 [P54760-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
A54092

NCBI Reference Sequences

More...
RefSeqi
NP_004435.3, NM_004444.4 [P54760-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000358173; ENSP00000350896; ENSG00000196411 [P54760-1]
ENST00000616502; ENSP00000482702; ENSG00000196411 [P54760-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
2050

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:2050

UCSC genome browser

More...
UCSCi
uc011kkg.2 human [P54760-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U07695 mRNA Translation: AAA20598.1
AF312032 Genomic DNA Translation: AAK21010.1
EU826608 mRNA Translation: ACF47644.1
EU826609 mRNA Translation: ACF47645.1
EU826610 mRNA Translation: ACF47646.1
BC0