Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A

Gene

PDE1A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Cyclic nucleotide phosphodiesterase with a dual-specificity for the second messengers cAMP and cGMP, which are key regulators of many important physiological processes. Has a higher affinity for cGMP than for cAMP.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

a divalent metal cationBy similarityNote: Binds 2 divalent metal cations per subunit. Site 1 may preferentially bind zinc ions, while site 2 has a preference for magnesium and/or manganese ions.By similarity

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Type I PDE are activated by the binding of calmodulin in the presence of Ca2+.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei219Proton donorBy similarity1
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi223Divalent metal cation 1; via tele nitrogenBy similarity1
Metal bindingi259Divalent metal cation 1; via tele nitrogenBy similarity1
Metal bindingi260Divalent metal cation 1By similarity1
Metal bindingi260Divalent metal cation 2By similarity1
Metal bindingi366Divalent metal cation 1By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalmodulin-binding, Hydrolase
LigandcAMP, cGMP, Metal-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.4.17 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-111957 Cam-PDE 1 activation
R-HSA-418457 cGMP effects
R-HSA-418555 G alpha (s) signalling events

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P54750

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A (EC:3.1.4.17)
Short name:
Cam-PDE 1A
Alternative name(s):
61 kDa Cam-PDE
hCam-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:PDE1A
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000115252.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:8774 PDE1A

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
171890 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P54750

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
5136

Open Targets

More...
OpenTargetsi
ENSG00000115252

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA33122

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3421

Drug and drug target database

More...
DrugBanki
DB01244 Bepridil
DB00201 Caffeine
DB01023 Felodipine
DB00622 Nicardipine

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
1294

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
PDE1A

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1705942

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001987851 – 535Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1AAdd BLAST535

Proteomic databases

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P54750

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P54750

PeptideAtlas

More...
PeptideAtlasi
P54750

PRoteomics IDEntifications database

More...
PRIDEi
P54750

ProteomicsDB human proteome resource

More...
ProteomicsDBi
56702
56703 [P54750-2]
56704 [P54750-3]
56705 [P54750-4]
56706 [P54750-5]
56707 [P54750-6]
56708 [P54750-7]
56709 [P54750-8]
56710 [P54750-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P54750

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P54750

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Several tissues, including brain, kidney, testes and heart.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000115252 Expressed in 195 organ(s), highest expression level in Brodmann (1909) area 23

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P54750 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA022151

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer.By similarity

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
111162, 4 interactors

Protein interaction database and analysis system

More...
IntActi
P54750, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000331574

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P54750

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P54750

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P54750

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini142 – 522PDEasePROSITE-ProRule annotationAdd BLAST381

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni24 – 44Calmodulin-bindingBy similarityAdd BLAST21

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3688 Eukaryota
ENOG410XQDD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157043

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG056120

KEGG Orthology (KO)

More...
KOi
K13755

Identification of Orthologs from Complete Genome Data

More...
OMAi
GTYSPDY

Database of Orthologous Groups

More...
OrthoDBi
EOG091G04C4

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P54750

TreeFam database of animal gene trees

More...
TreeFami
TF314638

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00077 HDc, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1300.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003607 HD/PDEase_dom
IPR023088 PDEase
IPR002073 PDEase_catalytic_dom
IPR036971 PDEase_catalytic_dom_sf
IPR023174 PDEase_CS
IPR013706 PDEase_N

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00233 PDEase_I, 1 hit
PF08499 PDEase_I_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00387 PDIESTERASE1

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00471 HDc, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00126 PDEASE_I_1, 1 hit
PS51845 PDEASE_I_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P54750-1) [UniParc]FASTAAdd to basket
Also known as: PDE1A3, PDE1A6

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSSATEIEE LENTTFKYLT GEQTEKMWQR LKGILRCLVK QLERGDVNVV
60 70 80 90 100
DLKKNIEYAA SVLEAVYIDE TRRLLDTEDE LSDIQTDSVP SEVRDWLAST
110 120 130 140 150
FTRKMGMTKK KPEEKPKFRS IVHAVQAGIF VERMYRKTYH MVGLAYPAAV
160 170 180 190 200
IVTLKDVDKW SFDVFALNEA SGEHSLKFMI YELFTRYDLI NRFKIPVSCL
210 220 230 240 250
ITFAEALEVG YSKYKNPYHN LIHAADVTQT VHYIMLHTGI MHWLTELEIL
260 270 280 290 300
AMVFAAAIHD YEHTGTTNNF HIQTRSDVAI LYNDRSVLEN HHVSAAYRLM
310 320 330 340 350
QEEEMNILIN LSKDDWRDLR NLVIEMVLST DMSGHFQQIK NIRNSLQQPE
360 370 380 390 400
GIDRAKTMSL ILHAADISHP AKSWKLHYRW TMALMEEFFL QGDKEAELGL
410 420 430 440 450
PFSPLCDRKS TMVAQSQIGF IDFIVEPTFS LLTDSTEKIV IPLIEEASKA
460 470 480 490 500
ETSSYVASSS TTIVGLHIAD ALRRSNTKGS MSDGSYSPDY SLAAVDLKSF
510 520 530
KNNLVDIIQQ NKERWKELAA QEARTSSQKC EFIHQ
Length:535
Mass (Da):61,252
Last modified:January 23, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iB1878145160BB3D7
GO
Isoform 2 (identifier: P54750-2) [UniParc]FASTAAdd to basket
Also known as: PDE1A4, PDE1A5

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR

Show »
Length:519
Mass (Da):59,592
Checksum:i51F86B0EF08C01CE
GO
Isoform 3 (identifier: P54750-3) [UniParc]FASTAAdd to basket
Also known as: PDE1A10

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: MGSSATEIEE...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE

Show »
Length:501
Mass (Da):57,483
Checksum:i74C082300051D62C
GO
Isoform 4 (identifier: P54750-4) [UniParc]FASTAAdd to basket
Also known as: PDE1A5

The sequence of this isoform differs from the canonical sequence as follows:
     522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS

Show »
Length:545
Mass (Da):62,309
Checksum:iBE2A280A504FDB9E
GO
Isoform 5 (identifier: P54750-5) [UniParc]FASTAAdd to basket
Also known as: PDE1A9

The sequence of this isoform differs from the canonical sequence as follows:
     522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL

Show »
Length:552
Mass (Da):63,040
Checksum:i0956259BB3F5E938
GO
Isoform 6 (identifier: P54750-6) [UniParc]FASTAAdd to basket
Also known as: PDE1A1

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR
     522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS

Show »
Length:529
Mass (Da):60,649
Checksum:i39CF97424CCC0CE2
GO
Isoform 7 (identifier: P54750-7) [UniParc]FASTAAdd to basket
Also known as: PDE1A8

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MGSSATEIEELENTTFKYLTGEQTEKMWQRLKGI → MDDHVTIRKKHLQRPIFR
     522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL

Show »
Length:536
Mass (Da):61,380
Checksum:i8CDAD40B298EB3FF
GO
Isoform 8 (identifier: P54750-8) [UniParc]FASTAAdd to basket
Also known as: PDE1A11

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: MGSSATEIEE...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE
     522-535: EARTSSQKCEFIHQ → GESDLHKNSEDLVNAEEKHDETHS

Show »
Length:511
Mass (Da):58,540
Checksum:i415D4C1242D9B547
GO
Isoform 9 (identifier: P54750-9) [UniParc]FASTAAdd to basket
Also known as: PDE1A12

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: MGSSATEIEE...LEAVYIDETR → MGKKINKLFC...IRKKVKNHIE
     522-535: EARTSSQKCEFIHQ → GSVVYEALLPSLSVFTSPLRVWITSSRFLLL

Show »
Length:518
Mass (Da):59,271
Checksum:i4C1AF30315076AF7
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0045481 – 72MGSSA…IDETR → MGKKINKLFCFNFLVQCFRG KSKPSKCQIRKKVKNHIE in isoform 3, isoform 8 and isoform 9. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_0045471 – 34MGSSA…RLKGI → MDDHVTIRKKHLQRPIFR in isoform 2, isoform 6 and isoform 7. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_004549522 – 535EARTS…EFIHQ → GESDLHKNSEDLVNAEEKHD ETHS in isoform 4, isoform 6 and isoform 8. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_004550522 – 535EARTS…EFIHQ → GSVVYEALLPSLSVFTSPLR VWITSSRFLLL in isoform 5, isoform 7 and isoform 9. CuratedAdd BLAST14

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U40370 mRNA Translation: AAC50436.1
AB038224 Genomic DNA Translation: BAB20049.1
AB038224 Genomic DNA Translation: BAB20050.1
AB038224 Genomic DNA Translation: BAB20051.1
AB038224 Genomic DNA Translation: BAB20052.1
AB038224 Genomic DNA Translation: BAB20053.1
AB038224 Genomic DNA Translation: BAB20054.1
AB038224 Genomic DNA Translation: BAB20055.1
AB038224 Genomic DNA Translation: BAB20056.1
AB038224 Genomic DNA Translation: BAB20057.1
AJ401610 mRNA Translation: CAC82208.1
AL110263 mRNA Translation: CAB53703.1
CH471058 Genomic DNA Translation: EAX10966.1
CH471058 Genomic DNA Translation: EAX10974.1
BC022480 mRNA Translation: AAH22480.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2285.1 [P54750-4]
CCDS33344.1 [P54750-1]
CCDS58741.1 [P54750-2]
CCDS74612.1 [P54750-3]
CCDS86900.1 [P54750-6]

Protein sequence database of the Protein Information Resource

More...
PIRi
T14783

NCBI Reference Sequences

More...
RefSeqi
NP_001003683.1, NM_001003683.2 [P54750-1]
NP_001245242.1, NM_001258313.1 [P54750-2]
NP_001245243.1, NM_001258314.1 [P54750-3]
NP_005010.2, NM_005019.4 [P54750-4]
XP_016859784.1, XM_017004295.1 [P54750-4]
XP_016859785.1, XM_017004296.1 [P54750-4]
XP_016859786.1, XM_017004297.1 [P54750-4]
XP_016859787.1, XM_017004298.1 [P54750-4]
XP_016859788.1, XM_017004299.1 [P54750-1]
XP_016859789.1, XM_017004300.1 [P54750-1]
XP_016859790.1, XM_017004301.1 [P54750-1]
XP_016859791.1, XM_017004302.1

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.191046
Hs.742065
Hs.742174

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000351439; ENSP00000309269; ENSG00000115252 [P54750-2]
ENST00000358139; ENSP00000350858; ENSG00000115252 [P54750-3]
ENST00000409365; ENSP00000386767; ENSG00000115252 [P54750-6]
ENST00000410103; ENSP00000387037; ENSG00000115252 [P54750-1]
ENST00000435564; ENSP00000410309; ENSG00000115252 [P54750-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
5136

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:5136

UCSC genome browser

More...
UCSCi
uc002uoq.3 human [P54750-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U40370 mRNA Translation: AAC50436.1
AB038224 Genomic DNA Translation: BAB20049.1
AB038224 Genomic DNA Translation: BAB20050.1
AB038224 Genomic DNA Translation: BAB20051.1
AB038224 Genomic DNA Translation: BAB20052.1
AB038224 Genomic DNA Translation: BAB20053.1
AB038224 Genomic DNA Translation: BAB20054.1
AB038224 Genomic DNA Translation: BAB20055.1
AB038224 Genomic DNA Translation: BAB20056.1
AB038224 Genomic DNA Translation: BAB20057.1
AJ401610 mRNA Translation: CAC82208.1
AL110263 mRNA Translation: CAB53703.1
CH471058 Genomic DNA Translation: EAX10966.1
CH471058 Genomic DNA Translation: EAX10974.1
BC022480 mRNA Translation: AAH22480.1
CCDSiCCDS2285.1 [P54750-4]
CCDS33344.1 [P54750-1]
CCDS58741.1 [P54750-2]
CCDS74612.1 [P54750-3]
CCDS86900.1 [P54750-6]
PIRiT14783
RefSeqiNP_001003683.1, NM_001003683.2 [P54750-1]
NP_001245242.1, NM_001258313.1 [P54750-2]
NP_001245243.1, NM_001258314.1 [P54750-3]
NP_005010.2, NM_005019.4 [P54750-4]
XP_016859784.1, XM_017004295.1 [P54750-4]
XP_016859785.1, XM_017004296.1 [P54750-4]
XP_016859786.1, XM_017004297.1 [P54750-4]
XP_016859787.1, XM_017004298.1 [P54750-4]
XP_016859788.1, XM_017004299.1 [P54750-1]
XP_016859789.1, XM_017004300.1 [P54750-1]
XP_016859790.1, XM_017004301.1 [P54750-1]
XP_016859791.1, XM_017004302.1
UniGeneiHs.191046
Hs.742065
Hs.742174

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1LXQmodel-A154-432[»]
ProteinModelPortaliP54750
SMRiP54750
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi111162, 4 interactors
IntActiP54750, 1 interactor
STRINGi9606.ENSP00000331574

Chemistry databases

BindingDBiP54750
ChEMBLiCHEMBL3421
DrugBankiDB01244 Bepridil
DB00201 Caffeine
DB01023 Felodipine
DB00622 Nicardipine
GuidetoPHARMACOLOGYi1294

PTM databases

iPTMnetiP54750
PhosphoSitePlusiP54750

Polymorphism and mutation databases

BioMutaiPDE1A
DMDMi1705942

Proteomic databases

MaxQBiP54750
PaxDbiP54750
PeptideAtlasiP54750
PRIDEiP54750
ProteomicsDBi56702
56703 [P54750-2]
56704 [P54750-3]
56705 [P54750-4]
56706 [P54750-5]
56707 [P54750-6]
56708 [P54750-7]
56709 [P54750-8]
56710 [P54750-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
5136
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000351439; ENSP00000309269; ENSG00000115252 [P54750-2]
ENST00000358139; ENSP00000350858; ENSG00000115252 [P54750-3]
ENST00000409365; ENSP00000386767; ENSG00000115252 [P54750-6]
ENST00000410103; ENSP00000387037; ENSG00000115252 [P54750-1]
ENST00000435564; ENSP00000410309; ENSG00000115252 [P54750-4]
GeneIDi5136
KEGGihsa:5136
UCSCiuc002uoq.3 human [P54750-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
5136
DisGeNETi5136
EuPathDBiHostDB:ENSG00000115252.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
PDE1A
HGNCiHGNC:8774 PDE1A
HPAiHPA022151
MIMi171890 gene
neXtProtiNX_P54750
OpenTargetsiENSG00000115252
PharmGKBiPA33122

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3688 Eukaryota
ENOG410XQDD LUCA
GeneTreeiENSGT00940000157043
HOVERGENiHBG056120
KOiK13755
OMAiGTYSPDY
OrthoDBiEOG091G04C4
PhylomeDBiP54750
TreeFamiTF314638

Enzyme and pathway databases

BRENDAi3.1.4.17 2681
ReactomeiR-HSA-111957 Cam-PDE 1 activation
R-HSA-418457 cGMP effects
R-HSA-418555 G alpha (s) signalling events
SIGNORiP54750

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
PDE1A human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
PDE1A

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
5136

Protein Ontology

More...
PROi
PR:P54750

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000115252 Expressed in 195 organ(s), highest expression level in Brodmann (1909) area 23
GenevisibleiP54750 HS

Family and domain databases

CDDicd00077 HDc, 1 hit
Gene3Di1.10.1300.10, 1 hit
InterProiView protein in InterPro
IPR003607 HD/PDEase_dom
IPR023088 PDEase
IPR002073 PDEase_catalytic_dom
IPR036971 PDEase_catalytic_dom_sf
IPR023174 PDEase_CS
IPR013706 PDEase_N
PfamiView protein in Pfam
PF00233 PDEase_I, 1 hit
PF08499 PDEase_I_N, 1 hit
PRINTSiPR00387 PDIESTERASE1
SMARTiView protein in SMART
SM00471 HDc, 1 hit
PROSITEiView protein in PROSITE
PS00126 PDEASE_I_1, 1 hit
PS51845 PDEASE_I_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPDE1A_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P54750
Secondary accession number(s): D3DPG5
, Q86VZ0, Q9C0K8, Q9C0K9, Q9C0L0, Q9C0L1, Q9C0L2, Q9C0L3, Q9C0L4, Q9UFX3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 23, 2007
Last modified: December 5, 2018
This is version 187 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again