Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hormone-sensitive lipase

Gene

Lipe

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

In adipose tissue and heart, it primarily hydrolyzes stored triglycerides to free fatty acids, while in steroidogenic tissues, it principally converts cholesteryl esters to free cholesterol for steroid hormone production.1 Publication

Catalytic activityi

Diacylglycerol + H2O = monoacylglycerol + a carboxylate.
Triacylglycerol + H2O = diacylglycerol + a carboxylate.
Monoacylglycerol + H2O = glycerol + a carboxylate.

Activity regulationi

Rapidly activated by cAMP-dependent phosphorylation under the influence of catecholamines. Dephosphorylation and inactivation are controlled by insulin (By similarity). Interacts with PLIN5.By similarity

Pathwayi: triacylglycerol degradation

This protein is involved in the pathway triacylglycerol degradation, which is part of Glycerolipid metabolism.
View all proteins of this organism that are known to be involved in the pathway triacylglycerol degradation and in Glycerolipid metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei423PROSITE-ProRule annotationBy similarity1
Active sitei694By similarity1
Active sitei724By similarity1

GO - Molecular functioni

  • acylglycerol lipase activity Source: MGI
  • hormone-sensitive lipase activity Source: UniProtKB-EC
  • hydrolase activity, acting on ester bonds Source: MGI
  • protein kinase binding Source: UniProtKB
  • rRNA primary transcript binding Source: UniProtKB
  • serine hydrolase activity Source: MGI
  • triglyceride lipase activity Source: MGI

GO - Biological processi

Keywordsi

Molecular functionHydrolase
Biological processCholesterol metabolism, Lipid degradation, Lipid metabolism, Steroid metabolism, Sterol metabolism

Enzyme and pathway databases

BRENDAi3.1.1.79 3474
UniPathwayi
UPA00256

Protein family/group databases

ESTHERimouse-hslip Hormone-sensitive_lipase_like
MEROPSiS09.993

Chemistry databases

SwissLipidsiSLP:000000313
SLP:000000314

Names & Taxonomyi

Protein namesi
Recommended name:
Hormone-sensitive lipase (EC:3.1.1.79)
Short name:
HSL
Gene namesi
Name:Lipe
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:96790 Lipe

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Chemistry databases

ChEMBLiCHEMBL5935

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000715481 – 759Hormone-sensitive lipaseAdd BLAST759

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei557PhosphoserineBy similarity1
Modified residuei559PhosphoserineCombined sources1
Modified residuei559Phosphoserine; by AMPKCombined sources1 Publication1
Modified residuei574PhosphothreonineCombined sources1
Modified residuei597PhosphoserineBy similarity1
Modified residuei618PhosphoserineBy similarity1
Modified residuei650PhosphoserineBy similarity1
Modified residuei651PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylation by AMPK may block translocation to lipid droplets.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP54310
PaxDbiP54310
PeptideAtlasiP54310
PRIDEiP54310

PTM databases

iPTMnetiP54310
PhosphoSitePlusiP54310

Expressioni

Gene expression databases

BgeeiENSMUSG00000003123 Expressed in 143 organ(s), highest expression level in epididymal fat pad
CleanExiMM_LIPE
ExpressionAtlasiP54310 baseline and differential
GenevisibleiP54310 MM

Interactioni

Subunit structurei

Interacts with CAVIN1 in the adipocyte cytoplasm (By similarity). Interacts with PLIN5 (PubMed:19717842).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000003207

Structurei

3D structure databases

ProteinModelPortaliP54310
SMRiP54310
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi349 – 351Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion holeBy similarity3

Sequence similaritiesi

Belongs to the 'GDXG' lipolytic enzyme family.Curated

Phylogenomic databases

eggNOGiKOG4388 Eukaryota
COG0657 LUCA
GeneTreeiENSGT00730000111056
HOGENOMiHOG000047722
HOVERGENiHBG000187
InParanoidiP54310
KOiK07188
TreeFamiTF314423

Family and domain databases

Gene3Di3.40.50.1820, 2 hits
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR013094 AB_hydrolase_3
IPR010468 HSL_N
IPR002168 Lipase_GDXG_HIS_AS
IPR033140 Lipase_GDXG_put_SER_AS
PfamiView protein in Pfam
PF07859 Abhydrolase_3, 2 hits
PF06350 HSL_N, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit
PROSITEiView protein in PROSITE
PS01173 LIPASE_GDXG_HIS, 1 hit
PS01174 LIPASE_GDXG_SER, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P54310-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDLRTMTQSL VTLAEDNMAF FSSQGPGETA RRLSNVFAGV REQALGLEPT
60 70 80 90 100
LGQLLGVAHH FDLDTETPAN GYRSLVHTAR CCLAHLLHKS RYVASNRKSI
110 120 130 140 150
FFRASHNLAE LEAYLAALTQ LRAMAYYAQR LLTINRPGVL FFEGDEGLTA
160 170 180 190 200
DFLQEYVTLH KGCFYGRCLG FQFTPAIRPF LQTLSIGLVS FGEHYKRNET
210 220 230 240 250
GLSVTASSLF TGGRFAIDPE LRGAEFERII QNLDVHFWKA FWNITEIEVL
260 270 280 290 300
SSLANMASTT VRVSRLLSLP PEAFEMPLTS DPRLTVTISP PLAHTGPAPV
310 320 330 340 350
LARLISYDLR EGQDSKVLNS LAKSEGPRLE LRPRPHQAPR SRALVVHIHG
360 370 380 390 400
GGFVAQTSKS HEPYLKNWAQ ELGVPIFSID YSLAPEAPFP RALEECFFAY
410 420 430 440 450
CWAVKHCDLL GSTGERICLA GDSAGGNLCI TVSLRAAAYG VRVPDGIMAA
460 470 480 490 500
YPVTTLQSSA SPSRLLSLMD PLLPLSVLSK CVSAYSGTEA EDHFDSDQKA
510 520 530 540 550
LGVMGLVQRD TSLFLRDLRL GASSWLNSFL ELSGRKPQKT TSPTAESVRP
560 570 580 590 600
TESMRRSVSE AALAQPEGLL GTDTLKKLTI KDLSNSEPSD SPEMSQSMET
610 620 630 640 650
LGPSTPSDVN FFLRPGNSQE EAEAKDEVRP MDGVPRVRAA FPEGFHPRRS
660 670 680 690 700
SQGVLHMPLY TSPIVKNPFM SPLLAPDSML KTLPPVHLVA CALDPMLDDS
710 720 730 740 750
VMFARRLRDL GQPVTLKVVE DLPHGFLSLA ALCRETRQAT EFCVQRIRLI

LTPPAAPLN
Length:759
Mass (Da):83,348
Last modified:January 24, 2006 - v2
Checksum:i3419AF52F6C85FF4
GO
Isoform 2 (identifier: P54310-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEPAVESAPVGAQASKQGKEGSKNRSRRRWRKGKIKASAFSHSM

Show »
Length:802
Mass (Da):88,027
Checksum:i3D0D4870E898AE5B
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q4M2E9Q4M2_MOUSE
Hormone-sensitive lipase
Lipe
1,072Annotation score:
A0A0U1RNR0A0A0U1RNR0_MOUSE
Hormone-sensitive lipase
Lipe
180Annotation score:
Q9D4C4Q9D4C4_MOUSE
Hormone-sensitive lipase
Lipe mCG_147818
334Annotation score:
A0A0U1RPJ0A0A0U1RPJ0_MOUSE
Hormone-sensitive lipase
Lipe
24Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti113A → T in BAE41414 (PubMed:16141072).Curated1
Sequence conflicti311E → D in BAE41414 (PubMed:16141072).Curated1
Sequence conflicti330 – 331EL → DV in AAC52163 (PubMed:7698747).Curated2
Sequence conflicti530L → P in AAC52163 (PubMed:7698747).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0533351M → MEPAVESAPVGAQASKQGKE GSKNRSRRRWRKGKIKASAF SHSM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08188 mRNA Translation: AAC52163.1
AF179427 Genomic DNA Translation: AAC53069.1
AC162443 Genomic DNA No translation available.
AC169209 Genomic DNA No translation available.
AK029984 mRNA Translation: BAC26716.1
AK169858 mRNA Translation: BAE41414.1
BC021642 mRNA Translation: AAH21642.1
CCDSiCCDS20981.1 [P54310-2]
CCDS20982.1 [P54310-1]
PIRiI49007
RefSeqiNP_001034596.1, NM_001039507.2 [P54310-1]
NP_034849.2, NM_010719.5 [P54310-2]
XP_006539634.1, XM_006539571.2 [P54310-1]
XP_006539635.1, XM_006539572.3 [P54310-1]
UniGeneiMm.158548
Mm.333679

Genome annotation databases

EnsembliENSMUST00000003207; ENSMUSP00000003207; ENSMUSG00000003123 [P54310-2]
ENSMUST00000054301; ENSMUSP00000050935; ENSMUSG00000003123 [P54310-1]
ENSMUST00000206861; ENSMUSP00000145665; ENSMUSG00000003123 [P54310-1]
GeneIDi16890
KEGGimmu:16890
UCSCiuc009fsp.1 mouse [P54310-1]
uc009fsr.1 mouse [P54310-2]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08188 mRNA Translation: AAC52163.1
AF179427 Genomic DNA Translation: AAC53069.1
AC162443 Genomic DNA No translation available.
AC169209 Genomic DNA No translation available.
AK029984 mRNA Translation: BAC26716.1
AK169858 mRNA Translation: BAE41414.1
BC021642 mRNA Translation: AAH21642.1
CCDSiCCDS20981.1 [P54310-2]
CCDS20982.1 [P54310-1]
PIRiI49007
RefSeqiNP_001034596.1, NM_001039507.2 [P54310-1]
NP_034849.2, NM_010719.5 [P54310-2]
XP_006539634.1, XM_006539571.2 [P54310-1]
XP_006539635.1, XM_006539572.3 [P54310-1]
UniGeneiMm.158548
Mm.333679

3D structure databases

ProteinModelPortaliP54310
SMRiP54310
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000003207

Chemistry databases

ChEMBLiCHEMBL5935
SwissLipidsiSLP:000000313
SLP:000000314

Protein family/group databases

ESTHERimouse-hslip Hormone-sensitive_lipase_like
MEROPSiS09.993

PTM databases

iPTMnetiP54310
PhosphoSitePlusiP54310

Proteomic databases

MaxQBiP54310
PaxDbiP54310
PeptideAtlasiP54310
PRIDEiP54310

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000003207; ENSMUSP00000003207; ENSMUSG00000003123 [P54310-2]
ENSMUST00000054301; ENSMUSP00000050935; ENSMUSG00000003123 [P54310-1]
ENSMUST00000206861; ENSMUSP00000145665; ENSMUSG00000003123 [P54310-1]
GeneIDi16890
KEGGimmu:16890
UCSCiuc009fsp.1 mouse [P54310-1]
uc009fsr.1 mouse [P54310-2]

Organism-specific databases

CTDi3991
MGIiMGI:96790 Lipe

Phylogenomic databases

eggNOGiKOG4388 Eukaryota
COG0657 LUCA
GeneTreeiENSGT00730000111056
HOGENOMiHOG000047722
HOVERGENiHBG000187
InParanoidiP54310
KOiK07188
TreeFamiTF314423

Enzyme and pathway databases

UniPathwayi
UPA00256

BRENDAi3.1.1.79 3474

Miscellaneous databases

PROiPR:P54310
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000003123 Expressed in 143 organ(s), highest expression level in epididymal fat pad
CleanExiMM_LIPE
ExpressionAtlasiP54310 baseline and differential
GenevisibleiP54310 MM

Family and domain databases

Gene3Di3.40.50.1820, 2 hits
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR013094 AB_hydrolase_3
IPR010468 HSL_N
IPR002168 Lipase_GDXG_HIS_AS
IPR033140 Lipase_GDXG_put_SER_AS
PfamiView protein in Pfam
PF07859 Abhydrolase_3, 2 hits
PF06350 HSL_N, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit
PROSITEiView protein in PROSITE
PS01173 LIPASE_GDXG_HIS, 1 hit
PS01174 LIPASE_GDXG_SER, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiLIPS_MOUSE
AccessioniPrimary (citable) accession number: P54310
Secondary accession number(s): P97866
, Q3TE34, Q6GU16, Q8CDI9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 24, 2006
Last modified: November 7, 2018
This is version 155 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again