Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hormone-sensitive lipase

Gene

Lipe

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

In adipose tissue and heart, it primarily hydrolyzes stored triglycerides to free fatty acids, while in steroidogenic tissues, it principally converts cholesteryl esters to free cholesterol for steroid hormone production.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Rapidly activated by cAMP-dependent phosphorylation under the influence of catecholamines. Dephosphorylation and inactivation are controlled by insulin (By similarity). Interacts with PLIN5.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: triacylglycerol degradation

This protein is involved in the pathway triacylglycerol degradation, which is part of Glycerolipid metabolism.
View all proteins of this organism that are known to be involved in the pathway triacylglycerol degradation and in Glycerolipid metabolism.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei423PROSITE-ProRule annotationBy similarity1
Active sitei694By similarity1
Active sitei724By similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • acylglycerol lipase activity Source: MGI
  • hormone-sensitive lipase activity Source: UniProtKB-EC
  • hydrolase activity, acting on ester bonds Source: MGI
  • protein kinase binding Source: UniProtKB
  • rRNA primary transcript binding Source: UniProtKB
  • serine hydrolase activity Source: MGI
  • triglyceride lipase activity Source: MGI

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase
Biological processCholesterol metabolism, Lipid degradation, Lipid metabolism, Steroid metabolism, Sterol metabolism

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
3.1.1.79 3474

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00256

Protein family/group databases

ESTHER database of the Alpha/Beta-hydrolase fold superfamily of proteins

More...
ESTHERi
mouse-hslip Hormone-sensitive_lipase_like

MEROPS protease database

More...
MEROPSi
S09.993

Chemistry databases

SwissLipids knowledge resource for lipid biology

More...
SwissLipidsi
SLP:000000313
SLP:000000314

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Hormone-sensitive lipase (EC:3.1.1.79)
Short name:
HSL
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Lipe
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:96790 Lipe

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5935

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000715481 – 759Hormone-sensitive lipaseAdd BLAST759

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei557PhosphoserineBy similarity1
Modified residuei559PhosphoserineCombined sources1
Modified residuei559Phosphoserine; by AMPKCombined sources1 Publication1
Modified residuei574PhosphothreonineCombined sources1
Modified residuei597PhosphoserineBy similarity1
Modified residuei618PhosphoserineBy similarity1
Modified residuei650PhosphoserineBy similarity1
Modified residuei651PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylation by AMPK may block translocation to lipid droplets.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P54310

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P54310

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P54310

PeptideAtlas

More...
PeptideAtlasi
P54310

PRoteomics IDEntifications database

More...
PRIDEi
P54310

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P54310

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P54310

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000003123 Expressed in 143 organ(s), highest expression level in epididymal fat pad

CleanEx database of gene expression profiles

More...
CleanExi
MM_LIPE

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P54310 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P54310 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CAVIN1 in the adipocyte cytoplasm (By similarity). Interacts with PLIN5 (PubMed:19717842).By similarity1 Publication

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000003207

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P54310

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P54310

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi349 – 351Involved in the stabilization of the negatively charged intermediate by the formation of the oxyanion holeBy similarity3

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the 'GDXG' lipolytic enzyme family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4388 Eukaryota
COG0657 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00730000111056

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000047722

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000187

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P54310

KEGG Orthology (KO)

More...
KOi
K07188

Database of Orthologous Groups

More...
OrthoDBi
1263520at2759

TreeFam database of animal gene trees

More...
TreeFami
TF314423

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.50.1820, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029058 AB_hydrolase
IPR013094 AB_hydrolase_3
IPR010468 HSL_N
IPR002168 Lipase_GDXG_HIS_AS
IPR033140 Lipase_GDXG_put_SER_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07859 Abhydrolase_3, 2 hits
PF06350 HSL_N, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53474 SSF53474, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01173 LIPASE_GDXG_HIS, 1 hit
PS01174 LIPASE_GDXG_SER, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P54310-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDLRTMTQSL VTLAEDNMAF FSSQGPGETA RRLSNVFAGV REQALGLEPT
60 70 80 90 100
LGQLLGVAHH FDLDTETPAN GYRSLVHTAR CCLAHLLHKS RYVASNRKSI
110 120 130 140 150
FFRASHNLAE LEAYLAALTQ LRAMAYYAQR LLTINRPGVL FFEGDEGLTA
160 170 180 190 200
DFLQEYVTLH KGCFYGRCLG FQFTPAIRPF LQTLSIGLVS FGEHYKRNET
210 220 230 240 250
GLSVTASSLF TGGRFAIDPE LRGAEFERII QNLDVHFWKA FWNITEIEVL
260 270 280 290 300
SSLANMASTT VRVSRLLSLP PEAFEMPLTS DPRLTVTISP PLAHTGPAPV
310 320 330 340 350
LARLISYDLR EGQDSKVLNS LAKSEGPRLE LRPRPHQAPR SRALVVHIHG
360 370 380 390 400
GGFVAQTSKS HEPYLKNWAQ ELGVPIFSID YSLAPEAPFP RALEECFFAY
410 420 430 440 450
CWAVKHCDLL GSTGERICLA GDSAGGNLCI TVSLRAAAYG VRVPDGIMAA
460 470 480 490 500
YPVTTLQSSA SPSRLLSLMD PLLPLSVLSK CVSAYSGTEA EDHFDSDQKA
510 520 530 540 550
LGVMGLVQRD TSLFLRDLRL GASSWLNSFL ELSGRKPQKT TSPTAESVRP
560 570 580 590 600
TESMRRSVSE AALAQPEGLL GTDTLKKLTI KDLSNSEPSD SPEMSQSMET
610 620 630 640 650
LGPSTPSDVN FFLRPGNSQE EAEAKDEVRP MDGVPRVRAA FPEGFHPRRS
660 670 680 690 700
SQGVLHMPLY TSPIVKNPFM SPLLAPDSML KTLPPVHLVA CALDPMLDDS
710 720 730 740 750
VMFARRLRDL GQPVTLKVVE DLPHGFLSLA ALCRETRQAT EFCVQRIRLI

LTPPAAPLN
Length:759
Mass (Da):83,348
Last modified:January 24, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3419AF52F6C85FF4
GO
Isoform 2 (identifier: P54310-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEPAVESAPVGAQASKQGKEGSKNRSRRRWRKGKIKASAFSHSM

Show »
Length:802
Mass (Da):88,027
Checksum:i3D0D4870E898AE5B
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9Q4M2E9Q4M2_MOUSE
Hormone-sensitive lipase
Lipe
1,072Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RNR0A0A0U1RNR0_MOUSE
Hormone-sensitive lipase
Lipe
180Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
Q9D4C4Q9D4C4_MOUSE
Hormone-sensitive lipase
Lipe mCG_147818
334Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0U1RPJ0A0A0U1RPJ0_MOUSE
Hormone-sensitive lipase
Lipe
24Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti113A → T in BAE41414 (PubMed:16141072).Curated1
Sequence conflicti311E → D in BAE41414 (PubMed:16141072).Curated1
Sequence conflicti330 – 331EL → DV in AAC52163 (PubMed:7698747).Curated2
Sequence conflicti530L → P in AAC52163 (PubMed:7698747).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0533351M → MEPAVESAPVGAQASKQGKE GSKNRSRRRWRKGKIKASAF SHSM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
U08188 mRNA Translation: AAC52163.1
AF179427 Genomic DNA Translation: AAC53069.1
AC162443 Genomic DNA No translation available.
AC169209 Genomic DNA No translation available.
AK029984 mRNA Translation: BAC26716.1
AK169858 mRNA Translation: BAE41414.1
BC021642 mRNA Translation: AAH21642.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS20981.1 [P54310-2]
CCDS20982.1 [P54310-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
I49007

NCBI Reference Sequences

More...
RefSeqi
NP_001034596.1, NM_001039507.2 [P54310-1]
NP_034849.2, NM_010719.5 [P54310-2]
XP_006539634.1, XM_006539571.2 [P54310-1]
XP_006539635.1, XM_006539572.3 [P54310-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.158548
Mm.333679

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000003207; ENSMUSP00000003207; ENSMUSG00000003123 [P54310-2]
ENSMUST00000054301; ENSMUSP00000050935; ENSMUSG00000003123 [P54310-1]
ENSMUST00000206861; ENSMUSP00000145665; ENSMUSG00000003123 [P54310-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
16890

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:16890

UCSC genome browser

More...
UCSCi
uc009fsp.1 mouse [P54310-1]
uc009fsr.1 mouse [P54310-2]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U08188 mRNA Translation: AAC52163.1
AF179427 Genomic DNA Translation: AAC53069.1
AC162443 Genomic DNA No translation available.
AC169209 Genomic DNA No translation available.
AK029984 mRNA Translation: BAC26716.1
AK169858 mRNA Translation: BAE41414.1
BC021642 mRNA Translation: AAH21642.1
CCDSiCCDS20981.1 [P54310-2]
CCDS20982.1 [P54310-1]
PIRiI49007
RefSeqiNP_001034596.1, NM_001039507.2 [P54310-1]
NP_034849.2, NM_010719.5 [P54310-2]
XP_006539634.1, XM_006539571.2 [P54310-1]
XP_006539635.1, XM_006539572.3 [P54310-1]
UniGeneiMm.158548
Mm.333679

3D structure databases

ProteinModelPortaliP54310
SMRiP54310
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000003207

Chemistry databases

ChEMBLiCHEMBL5935
SwissLipidsiSLP:000000313
SLP:000000314

Protein family/group databases

ESTHERimouse-hslip Hormone-sensitive_lipase_like
MEROPSiS09.993

PTM databases

iPTMnetiP54310
PhosphoSitePlusiP54310

Proteomic databases

jPOSTiP54310
MaxQBiP54310
PaxDbiP54310
PeptideAtlasiP54310
PRIDEiP54310

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000003207; ENSMUSP00000003207; ENSMUSG00000003123 [P54310-2]
ENSMUST00000054301; ENSMUSP00000050935; ENSMUSG00000003123 [P54310-1]
ENSMUST00000206861; ENSMUSP00000145665; ENSMUSG00000003123 [P54310-1]
GeneIDi16890
KEGGimmu:16890
UCSCiuc009fsp.1 mouse [P54310-1]
uc009fsr.1 mouse [P54310-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3991
MGIiMGI:96790 Lipe

Phylogenomic databases

eggNOGiKOG4388 Eukaryota
COG0657 LUCA
GeneTreeiENSGT00730000111056
HOGENOMiHOG000047722
HOVERGENiHBG000187
InParanoidiP54310
KOiK07188
OrthoDBi1263520at2759
TreeFamiTF314423

Enzyme and pathway databases

UniPathwayi
UPA00256

BRENDAi3.1.1.79 3474

Miscellaneous databases

Protein Ontology

More...
PROi
PR:P54310

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000003123 Expressed in 143 organ(s), highest expression level in epididymal fat pad
CleanExiMM_LIPE
ExpressionAtlasiP54310 baseline and differential
GenevisibleiP54310 MM

Family and domain databases

Gene3Di3.40.50.1820, 2 hits
InterProiView protein in InterPro
IPR029058 AB_hydrolase
IPR013094 AB_hydrolase_3
IPR010468 HSL_N
IPR002168 Lipase_GDXG_HIS_AS
IPR033140 Lipase_GDXG_put_SER_AS
PfamiView protein in Pfam
PF07859 Abhydrolase_3, 2 hits
PF06350 HSL_N, 1 hit
SUPFAMiSSF53474 SSF53474, 1 hit
PROSITEiView protein in PROSITE
PS01173 LIPASE_GDXG_HIS, 1 hit
PS01174 LIPASE_GDXG_SER, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLIPS_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P54310
Secondary accession number(s): P97866
, Q3TE34, Q6GU16, Q8CDI9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 24, 2006
Last modified: January 16, 2019
This is version 157 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again