Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 156 (02 Jun 2021)
Sequence version 1 (01 Oct 1996)
Previous versions | rss
Add a publicationFeedback
Protein

Voltage-dependent L-type calcium channel subunit beta-2

Gene

CACNB2

Organism
Oryctolagus cuniculus (Rabbit)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections ('Function', 'PTM / Processing', 'Pathology and Biotech') according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei521Required for CaMK2D-bindingBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-2
Short name:
CAB2
Alternative name(s):
Calcium channel voltage-dependent subunit beta 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CACNB2
Synonyms:CACNLB2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiOryctolagus cuniculus (Rabbit)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9986 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresLagomorphaLeporidaeOryctolagus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000001811 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3638171

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001440531 – 632Voltage-dependent L-type calcium channel subunit beta-2Add BLAST632

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei176PhosphoserineBy similarity1
Modified residuei179PhosphoserineBy similarity1
Modified residuei190PhosphoserineBy similarity1
Modified residuei522PhosphoserineBy similarity1
Modified residuei526Phosphothreonine; by CaMK2DBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Regulated through phosphorylation at Thr-526 by CaMK2D.By similarity

Keywords - PTMi

Phosphoprotein

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P54288

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in heart, aorta and brain.

Gene expression databases

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P54288, baseline

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of a calcium channel complex consisting of a pore-forming alpha subunit (CACNA1S) and the ancillary subunits CACNB1 or CACNB2, CACNG1 and CACNA2D1 (PubMed:15134636). The channel complex contains alpha, beta, gamma and delta subunits in a 1:1:1:1 ratio, i.e. it contains either CACNB1 or CACNB2 (By similarity).

Interacts with CACNA1C (PubMed:22649239).

Interacts with RRAD. Interaction with RRAD regulates the trafficking of CACNA1C to the cell membrane.

Interacts with TMIGD2 (By similarity).

Interacts with CAMK2D.

Interacts with CBARP (By similarity).

Interacts with CAMK2A (By similarity).

By similarity1 Publication1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
1172298, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9986.ENSOCUP00000021223

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1632
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P54288

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P54288

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini86 – 155SH3PROSITE-ProRule annotationAdd BLAST70

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni20 – 64DisorderedSequence analysisAdd BLAST45
Regioni162 – 233DisorderedSequence analysisAdd BLAST72
Regioni460 – 610DisorderedSequence analysisAdd BLAST151

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi28 – 55Polar residuesSequence analysisAdd BLAST28
Compositional biasi166 – 197Polar residuesSequence analysisAdd BLAST32
Compositional biasi216 – 230Polar residuesSequence analysisAdd BLAST15
Compositional biasi460 – 483Polar residuesSequence analysisAdd BLAST24
Compositional biasi510 – 525Polar residuesSequence analysisAdd BLAST16
Compositional biasi526 – 610Basic and acidic residuesSequence analysisAdd BLAST85

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3812, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000182837

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P54288

Database of Orthologous Groups

More...
OrthoDBi
926074at2759

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12040, SH3_CACNB2, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035605, CACNB2_SH3
IPR008145, GK/Ca_channel_bsu
IPR027417, P-loop_NTPase
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
IPR005444, VDCC_L_b2su
IPR000584, VDCC_L_bsu

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00625, Guanylate_kin, 1 hit
PF12052, VGCC_beta4Aa_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01626, LCACHANNELB
PR01628, LCACHANNELB2

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00072, GuKc, 1 hit
SM00326, SH3, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF50044, SSF50044, 1 hit
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50002, SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2B (identifier: P54288-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNQASGLDLL KISYGKGARR KNRFKGSDGS TSSDTTSNSF VRQGSADSYT
60 70 80 90 100
SRPSDSDVSL EEDREAVRRE AERQAQAQLE KAKTKPVAFA VRTNVSYSAA
110 120 130 140 150
HEDDVPVPGM AISFEAKDFL HVKEKFNNDW WIGRLVKEGC EIGFIPSPVK
160 170 180 190 200
LENMRLQHEQ RAKQGKFYSS KSGGNSSSSL GDIVPSSRKS TPPSSAIDID
210 220 230 240 250
ATGLDAEEND IPANHRSPKP SANSVTSPHS KEKRMPFFKK TEHTPPYDVV
260 270 280 290 300
PSMRPVVLVG PSLKGYEVTD MMQKALFDFL KHRFEGRISI TRVTADISLA
310 320 330 340 350
KRSVLNNPSK HAIIERSNTR SSLAEVQSEI ERIFELARTL QLVVLDADTI
360 370 380 390 400
NHPAQLSKTS LAPIVVYVKI SSPKVLQRLI KSRGKSQAKH LNVQMVAADK
410 420 430 440 450
LAQCPPELFD VILDENQLED ACEHLADYLE AYWKATHPPS SNLPNPLLSR
460 470 480 490 500
TLATSALPVS PTLASNSQGS QGDQRTDRSA PARSASQAEE EPCLEPAKKS
510 520 530 540 550
QHRSSSSAPH HNHRSGTSRG LSRQETFDSE TQESRDSAYV EPKEDYSHEH
560 570 580 590 600
VDHYAPHRDH NHRDETHRSS DHRHRETRHR SRDMDREQDH NECNKQRSRH
610 620 630
KSKDRYCDKD GEVISKKRNE AGEWNRDVYI RQ
Length:632
Mass (Da):70,944
Last modified:October 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEB6873D1F8DEB5D4
GO
Isoform 2A (identifier: P54288-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MNQASGLDLLKISYGKGARRKNRFKGSDGSTSSDTTSNSFVRQ → MLDRHLAAPHTQGLVLE

Show »
Length:606
Mass (Da):68,178
Checksum:i55534DED1FD2F804
GO
Isoform 2C (identifier: P54288-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     197-240: IDIDATGLDAEENDIPANHRSPKPSANSVTSPHSKEKRMPFFKK → KQKQKS

Show »
Length:594
Mass (Da):66,812
Checksum:i3E0705B34B1B7C65
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G1TVY1G1TVY1_RABIT
Calcium channel voltage-dependent s...
605Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9D9E5A0A5F9D9E5_RABIT
Calcium channel voltage-dependent s...
608Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9CF65A0A5F9CF65_RABIT
Calcium channel voltage-dependent s...
629Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9D4P2A0A5F9D4P2_RABIT
Calcium channel voltage-dependent s...
602Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9DIF5A0A5F9DIF5_RABIT
Calcium channel voltage-dependent s...
176Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A5F9DT99A0A5F9DT99_RABIT
Voltage-dependent L-type calcium ch...
410Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0006321 – 43MNQAS…SFVRQ → MLDRHLAAPHTQGLVLE in isoform 2A. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_000633197 – 240IDIDA…PFFKK → KQKQKS in isoform 2C. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X64298 mRNA Translation: CAA45576.1
X64297 mRNA Translation: CAA45575.1
X64299 mRNA Translation: CAA45577.1

Protein sequence database of the Protein Information Resource

More...
PIRi
S21046
S21048

NCBI Reference Sequences

More...
RefSeqi
NP_001075865.1, NM_001082396.1 [P54288-1]
XP_017203069.1, XM_017347580.1 [P54288-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSOCUT00000043808; ENSOCUP00000027460; ENSOCUG00000014849 [P54288-3]
ENSOCUT00000051118; ENSOCUP00000040459; ENSOCUG00000014849 [P54288-1]
ENSOCUT00000062808; ENSOCUP00000034129; ENSOCUG00000014849 [P54288-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100009277

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
ocu:100009277

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X64298 mRNA Translation: CAA45576.1
X64297 mRNA Translation: CAA45575.1
X64299 mRNA Translation: CAA45577.1
PIRiS21046
S21048
RefSeqiNP_001075865.1, NM_001082396.1 [P54288-1]
XP_017203069.1, XM_017347580.1 [P54288-3]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1T3LX-ray2.20A51-163[»]
A229-448[»]
1T3SX-ray2.30A51-163[»]
A229-422[»]
4DEXX-ray2.00A51-163[»]
A229-448[»]
4DEYX-ray1.95A51-163[»]
A229-448[»]
SMRiP54288
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi1172298, 1 interactor
STRINGi9986.ENSOCUP00000021223

Chemistry databases

ChEMBLiCHEMBL3638171

PTM databases

iPTMnetiP54288

Genome annotation databases

EnsembliENSOCUT00000043808; ENSOCUP00000027460; ENSOCUG00000014849 [P54288-3]
ENSOCUT00000051118; ENSOCUP00000040459; ENSOCUG00000014849 [P54288-1]
ENSOCUT00000062808; ENSOCUP00000034129; ENSOCUG00000014849 [P54288-2]
GeneIDi100009277
KEGGiocu:100009277

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
783

Phylogenomic databases

eggNOGiKOG3812, Eukaryota
GeneTreeiENSGT00950000182837
InParanoidiP54288
OrthoDBi926074at2759

Miscellaneous databases

EvolutionaryTraceiP54288

Gene expression databases

ExpressionAtlasiP54288, baseline

Family and domain databases

CDDicd12040, SH3_CACNB2, 1 hit
InterProiView protein in InterPro
IPR035605, CACNB2_SH3
IPR008145, GK/Ca_channel_bsu
IPR027417, P-loop_NTPase
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
IPR005444, VDCC_L_b2su
IPR000584, VDCC_L_bsu
PfamiView protein in Pfam
PF00625, Guanylate_kin, 1 hit
PF12052, VGCC_beta4Aa_N, 1 hit
PRINTSiPR01626, LCACHANNELB
PR01628, LCACHANNELB2
SMARTiView protein in SMART
SM00072, GuKc, 1 hit
SM00326, SH3, 1 hit
SUPFAMiSSF50044, SSF50044, 1 hit
SSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50002, SH3, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCACB2_RABIT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P54288
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: June 2, 2021
This is version 156 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again