Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P54284 (CACB3_HUMAN)

Entry version 197 (02 Jun 2021)
Sequence version 1 (01 Oct 1996)
Previous versions | rss
Add a publicationFeedback
Protein

Voltage-dependent L-type calcium channel subunit beta-3

Gene

CACNB3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulatory subunit of the voltage-gated calcium channel that gives rise to L-type calcium currents (PubMed:8119293).

Increases CACNA1B peak calcium current and shifts the voltage dependencies of channel activation and inactivation (By similarity).

Increases CACNA1C peak calcium current and shifts the voltage dependencies of channel activation and inactivation (By similarity).

By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P54284

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-112308, Presynaptic depolarization and calcium channel opening
R-HSA-400042, Adrenaline,noradrenaline inhibits insulin secretion
R-HSA-419037, NCAM1 interactions
R-HSA-422356, Regulation of insulin secretion

Protein family/group databases

Transport Classification Database

More...TCDBi		8.A.22.1.3, the ca(2+) channel auxiliary subunit Beta types 1-4 (cca-Beta) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-3
Short name:
CAB3
Alternative name(s):
Calcium channel voltage-dependent subunit beta 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CACNB3
Synonyms:CACNLB31 Publication
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:1403, CACNB3

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		601958, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P54284

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000167535.7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		784

Open Targets

More...OpenTargetsi		ENSG00000167535

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA89

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P54284, Tbio

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL3430901

Drug and drug target database

More...DrugBanki		DB01118, Amiodarone
DB09231, Benidipine
DB13746, Bioallethrin
DB11148, Butamben
DB11093, Calcium citrate
DB11348, Calcium Phosphate
DB14481, Calcium phosphate dihydrate
DB09232, Cilnidipine
DB04855, Dronedarone
DB00228, Enflurane
DB00153, Ergocalciferol
DB13961, Fish oil
DB09236, Lacidipine
DB00825, Levomenthol
DB00653, Magnesium sulfate
DB09238, Manidipine
DB01388, Mibefradil
DB01110, Miconazole
DB00393, Nimodipine
DB00252, Phenytoin
DB00243, Ranolazine
DB00421, Spironolactone
DB00273, Topiramate
DB09089, Trimebutine

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CACNB3

Domain mapping of disease mutations (DMDM)

More...DMDMi		1705683

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001440561 – 484Voltage-dependent L-type calcium channel subunit beta-3Add BLAST484

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei152PhosphoserineBy similarity1
Modified residuei393PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P54284

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P54284

MaxQB - The MaxQuant DataBase

More...MaxQBi		P54284

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P54284

PeptideAtlas

More...PeptideAtlasi		P54284

PRoteomics IDEntifications database

More...PRIDEi		P54284

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		25153
26032
28606
56673 [P54284-1]
56674 [P54284-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P54284

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P54284

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed mostly in brain, colon and ovary.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000167535, Expressed in right frontal lobe and 210 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P54284, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P54284, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000167535, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of a calcium channel complex consisting of a pore-forming alpha subunit (CACNA1C) and the ancillary subunits CACNB3 and CACNA2D1 (PubMed:29742403). The channel complex contains alpha, beta, gamma and delta subunits in a 1:1:1:1 ratio (Probable).

Interacts with CACNA2D4 (PubMed:12181424).

Interacts with FASLG (PubMed:19807924).

Interacts with CBARP; prevents the interaction of CACNB3 with the alpha subunit CACNA1C thereby negatively regulating the activity of the corresponding calcium channel (By similarity).

By similarityCurated3 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107238, 21 interactors

Database of interacting proteins

More...DIPi		DIP-39138N

Protein interaction database and analysis system

More...IntActi		P54284, 19 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000301050

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P54284

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P54284, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P54284

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini59 – 128SH3PROSITE-ProRule annotationAdd BLAST70

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 52DisorderedSequence analysisAdd BLAST52
Regioni129 – 170DisorderedSequence analysisAdd BLAST42
Regioni195 – 345Mediates interaction with the alpha subunitBy similarityAdd BLAST151
Regioni387 – 484DisorderedSequence analysisAdd BLAST98

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular type of amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi29 – 52Basic and acidic residuesSequence analysisAdd BLAST24
Compositional biasi136 – 159Polar residuesSequence analysisAdd BLAST24
Compositional biasi389 – 404Basic and acidic residuesSequence analysisAdd BLAST16
Compositional biasi405 – 420Polar residuesSequence analysisAdd BLAST16
Compositional biasi458 – 484Basic and acidic residuesSequence analysisAdd BLAST27

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the calcium channel beta subunit family.Curated

Keywords - Domaini

SH3 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3812, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182837

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_021995_0_1_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P54284

Identification of Orthologs from Complete Genome Data

More...OMAi		PCQGSAD

Database of Orthologous Groups

More...OrthoDBi		926074at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P54284

TreeFam database of animal gene trees

More...TreeFami		TF316195

Family and domain databases

Conserved Domains Database

More...CDDi		cd12042, SH3_CACNB3, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR035760, CACNB3_SH3
IPR008145, GK/Ca_channel_bsu
IPR027417, P-loop_NTPase
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
IPR008079, VDCC_L_b3su
IPR000584, VDCC_L_bsu

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00625, Guanylate_kin, 1 hit
PF12052, VGCC_beta4Aa_N, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR01626, LCACHANNELB
PR01696, LCACHANNELB3

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00072, GuKc, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50044, SSF50044, 1 hit
SSF52540, SSF52540, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50002, SH3, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P54284-1) [UniParc]FASTAAdd to basket
Also known as: 3A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYDDSYVPGF EDSEAGSADS YTSRPSLDSD VSLEEDRESA RREVESQAQQ 
        60         70         80         90        100
QLERAKHKPV AFAVRTNVSY CGVLDEECPV QGSGVNFEAK DFLHIKEKYS 
       110        120        130        140        150
NDWWIGRLVK EGGDIAFIPS PQRLESIRLK QEQKARRSGN PSSLSDIGNR 
       160        170        180        190        200
RSPPPSLAKQ KQKQAEHVPP YDVVPSMRPV VLVGPSLKGY EVTDMMQKAL 
       210        220        230        240        250
FDFLKHRFDG RISITRVTAD LSLAKRSVLN NPGKRTIIER SSARSSIAEV 
       260        270        280        290        300
QSEIERIFEL AKSLQLVVLD ADTINHPAQL AKTSLAPIIV FVKVSSPKVL 
       310        320        330        340        350
QRLIRSRGKS QMKHLTVQMM AYDKLVQCPP ESFDVILDEN QLEDACEHLA 
       360        370        380        390        400
EYLEVYWRAT HHPAPGPGLL GPPSAIPGLQ NQQLLGERGE EHSPLERDSL 
       410        420        430        440        450
MPSDEASESS RQAWTGSSQR SSRHLEEDYA DAYQDLYQPH RQHTSGLPSA 
       460        470        480 
NGHDPQDRLL AQDSEHNHSD RNWQRNRPWP KDSY
Length:484
Mass (Da):54,532
Last modified:October 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i19CD3549F5A8E17A
GO
Isoform 2 (identifier: P54284-2) [UniParc]FASTAAdd to basket
Also known as: 3B

The sequence of this isoform differs from the canonical sequence as follows:
     440-484: HRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY → QCQLLSLL

Show »
Length:447
Mass (Da):50,106
Checksum:iC2BCB90B9B4FEB3F
GO
Isoform 3 (identifier: P54284-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MYDDSYVPGFEDSEA → ME

Show »
Length:471
Mass (Da):53,085
Checksum:i37BA075B29E7A52C
GO
Isoform 4 (identifier: P54284-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MYDDSYVPGFEDSEA → MSFSDSSATFLLNE

Show »
Length:483
Mass (Da):54,356
Checksum:iC979431C760076AF
GO
Isoform 5 (identifier: P54284-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     57-97: Missing.

Show »
Length:443
Mass (Da):50,015
Checksum:i6A689973F8712530
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VNV8F8VNV8_HUMAN
Calcium channel voltage-dependent s...
CACNB3
457Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VV14F8VV14_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
151Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VWK1F8VWK1_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W0F8F8W0F8_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHY2H0YHY2_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VUW8F8VUW8_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
122Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VU10F8VU10_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
55Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W1N3F8W1N3_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
37Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHK1H0YHK1_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti7V → L in AAA19799 (PubMed:8119293).Curated1
Sequence conflicti32Missing in AAA19799 (PubMed:8119293).Curated1
Sequence conflicti60V → E in AAA19799 (PubMed:8119293).Curated1
Sequence conflicti101N → D in BAH14694 (PubMed:14702039).Curated1
Sequence conflicti162Q → R in BAH14209 (PubMed:14702039).Curated1
Sequence conflicti196M → T in BAH12637 (PubMed:14702039).Curated1
Sequence conflicti245S → P in BAH12637 (PubMed:14702039).Curated1
Sequence conflicti320Missing in AAA19799 (PubMed:8119293).Curated1
Sequence conflicti348H → L in AAA19799 (PubMed:8119293).Curated1
Sequence conflicti421S → T in AAA19799 (PubMed:8119293).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_024384423R → H. Corresponds to variant dbSNP:rs2229954Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0467081 – 15MYDDS…EDSEA → ME in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_0467091 – 15MYDDS…EDSEA → MSFSDSSATFLLNE in isoform 4. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_04671057 – 97Missing in isoform 5. CuratedAdd BLAST41
Alternative sequenceiVSP_000634440 – 484HRQHT…PKDSY → QCQLLSLL in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X76555 mRNA Translation: CAA54055.1
X76556 mRNA Translation: CAA54056.1
D43704 Genomic DNA Translation: BAA07803.1
U07139 mRNA Translation: AAA95958.1
L27584 mRNA Translation: AAA19799.1
AK289709 mRNA Translation: BAF82398.1
AK297639 mRNA Translation: BAH12637.1
AK304537 mRNA Translation: BAH14209.1
AK316323 mRNA Translation: BAH14694.1
AC117498 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58008.1
BC041811 mRNA Translation: AAH41811.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS55821.1 [P54284-3]
CCDS55822.1 [P54284-4]
CCDS55823.1 [P54284-5]
CCDS8769.1 [P54284-1]

Protein sequence database of the Protein Information Resource

More...PIRi		S39315
S39316
S41211

NCBI Reference Sequences

More...RefSeqi		NP_000716.2, NM_000725.3 [P54284-1]
NP_001193844.1, NM_001206915.1 [P54284-5]
NP_001193845.1, NM_001206916.1 [P54284-4]
NP_001193846.1, NM_001206917.1 [P54284-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000301050; ENSP00000301050; ENSG00000167535 [P54284-1]
ENST00000536187; ENSP00000444160; ENSG00000167535 [P54284-4]
ENST00000540990; ENSP00000445495; ENSG00000167535 [P54284-3]
ENST00000547230; ENSP00000448304; ENSG00000167535 [P54284-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		784

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:784

UCSC genome browser

More...UCSCi		uc001rsl.3, human [P54284-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X76555 mRNA Translation: CAA54055.1
X76556 mRNA Translation: CAA54056.1
D43704 Genomic DNA Translation: BAA07803.1
U07139 mRNA Translation: AAA95958.1
L27584 mRNA Translation: AAA19799.1
AK289709 mRNA Translation: BAF82398.1
AK297639 mRNA Translation: BAH12637.1
AK304537 mRNA Translation: BAH14209.1
AK316323 mRNA Translation: BAH14694.1
AC117498 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58008.1
BC041811 mRNA Translation: AAH41811.1
CCDSiCCDS55821.1 [P54284-3]
CCDS55822.1 [P54284-4]
CCDS55823.1 [P54284-5]
CCDS8769.1 [P54284-1]
PIRiS39315
S39316
S41211
RefSeqiNP_000716.2, NM_000725.3 [P54284-1]
NP_001193844.1, NM_001206915.1 [P54284-5]
NP_001193845.1, NM_001206916.1 [P54284-4]
NP_001193846.1, NM_001206917.1 [P54284-3]

3D structure databases

SMRiP54284
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi107238, 21 interactors
DIPiDIP-39138N
IntActiP54284, 19 interactors
STRINGi9606.ENSP00000301050

Chemistry databases

BindingDBiP54284
ChEMBLiCHEMBL3430901
DrugBankiDB01118, Amiodarone
DB09231, Benidipine
DB13746, Bioallethrin
DB11148, Butamben
DB11093, Calcium citrate
DB11348, Calcium Phosphate
DB14481, Calcium phosphate dihydrate
DB09232, Cilnidipine
DB04855, Dronedarone
DB00228, Enflurane
DB00153, Ergocalciferol
DB13961, Fish oil
DB09236, Lacidipine
DB00825, Levomenthol
DB00653, Magnesium sulfate
DB09238, Manidipine
DB01388, Mibefradil
DB01110, Miconazole
DB00393, Nimodipine
DB00252, Phenytoin
DB00243, Ranolazine
DB00421, Spironolactone
DB00273, Topiramate
DB09089, Trimebutine

Protein family/group databases

TCDBi8.A.22.1.3, the ca(2+) channel auxiliary subunit Beta types 1-4 (cca-Beta) family

PTM databases

iPTMnetiP54284
PhosphoSitePlusiP54284

Genetic variation databases

BioMutaiCACNB3
DMDMi1705683

Proteomic databases

jPOSTiP54284
MassIVEiP54284
MaxQBiP54284
PaxDbiP54284
PeptideAtlasiP54284
PRIDEiP54284
ProteomicsDBi25153
26032
28606
56673 [P54284-1]
56674 [P54284-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		13690, 209 antibodies

The DNASU plasmid repository

More...DNASUi		784

Genome annotation databases

EnsembliENST00000301050; ENSP00000301050; ENSG00000167535 [P54284-1]
ENST00000536187; ENSP00000444160; ENSG00000167535 [P54284-4]
ENST00000540990; ENSP00000445495; ENSG00000167535 [P54284-3]
ENST00000547230; ENSP00000448304; ENSG00000167535 [P54284-5]
GeneIDi784
KEGGihsa:784
UCSCiuc001rsl.3, human [P54284-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		784
DisGeNETi784

GeneCards: human genes, protein and diseases

More...GeneCardsi		CACNB3
HGNCiHGNC:1403, CACNB3
HPAiENSG00000167535, Tissue enhanced (brain)
MIMi601958, gene
neXtProtiNX_P54284
OpenTargetsiENSG00000167535
PharmGKBiPA89
VEuPathDBiHostDB:ENSG00000167535.7

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3812, Eukaryota
GeneTreeiENSGT00950000182837
HOGENOMiCLU_021995_0_1_1
InParanoidiP54284
OMAiPCQGSAD
OrthoDBi926074at2759
PhylomeDBiP54284
TreeFamiTF316195

Enzyme and pathway databases

PathwayCommonsiP54284
ReactomeiR-HSA-112308, Presynaptic depolarization and calcium channel opening
R-HSA-400042, Adrenaline,noradrenaline inhibits insulin secretion
R-HSA-419037, NCAM1 interactions
R-HSA-422356, Regulation of insulin secretion

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		784, 202 hits in 988 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CACNB3, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		CACNB3

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		784
PharosiP54284, Tbio

Protein Ontology

More...PROi		PR:P54284
RNActiP54284, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000167535, Expressed in right frontal lobe and 210 other tissues
ExpressionAtlasiP54284, baseline and differential
GenevisibleiP54284, HS

Family and domain databases

CDDicd12042, SH3_CACNB3, 1 hit
InterProiView protein in InterPro
IPR035760, CACNB3_SH3
IPR008145, GK/Ca_channel_bsu
IPR027417, P-loop_NTPase
IPR036028, SH3-like_dom_sf
IPR001452, SH3_domain
IPR008079, VDCC_L_b3su
IPR000584, VDCC_L_bsu
PfamiView protein in Pfam
PF00625, Guanylate_kin, 1 hit
PF12052, VGCC_beta4Aa_N, 1 hit
PRINTSiPR01626, LCACHANNELB
PR01696, LCACHANNELB3
SMARTiView protein in SMART
SM00072, GuKc, 1 hit
SUPFAMiSSF50044, SSF50044, 1 hit
SSF52540, SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50002, SH3, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCACB3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P54284
Secondary accession number(s): A8K0Z4
, B7Z4Q1, B7Z973, B7ZAK8, F5GZW7, F5H2P6, F8VSG3, Q13913
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: June 2, 2021
This is version 197 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again