Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Voltage-dependent L-type calcium channel subunit beta-3

Gene

CACNB3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulatory subunit of the voltage-gated calcium channel that gives rise to L-type calcium currents (PubMed:8119293). Increases CACNA1B peak calcium current and shifts the voltage dependencies of channel activation and inactivation (By similarity). Increases CACNA1C peak calcium current and shifts the voltage dependencies of channel activation and inactivation (By similarity).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionCalcium channel, Ion channel, Voltage-gated channel
Biological processCalcium transport, Ion transport, Transport
LigandCalcium

Enzyme and pathway databases

ReactomeiR-HSA-112308 Presynaptic depolarization and calcium channel opening
R-HSA-400042 Adrenaline,noradrenaline inhibits insulin secretion
R-HSA-419037 NCAM1 interactions
R-HSA-422356 Regulation of insulin secretion
R-HSA-5576892 Phase 0 - rapid depolarisation
R-HSA-5576893 Phase 2 - plateau phase

Protein family/group databases

TCDBi8.A.22.1.3 the ca(2+) channel auxiliary subunit Beta types 1-4 (cca-Beta) family

Names & Taxonomyi

Protein namesi
Recommended name:
Voltage-dependent L-type calcium channel subunit beta-3
Short name:
CAB3
Alternative name(s):
Calcium channel voltage-dependent subunit beta 3
Gene namesi
Name:CACNB3
Synonyms:CACNLB31 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000167535.7
HGNCiHGNC:1403 CACNB3
MIMi601958 gene
neXtProtiNX_P54284

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi784
OpenTargetsiENSG00000167535
PharmGKBiPA89

Chemistry databases

ChEMBLiCHEMBL3430901
DrugBankiDB04855 Dronedarone
DB01388 Mibefradil
DB00393 Nimodipine
DB00421 Spironolactone
DB00661 Verapamil

Polymorphism and mutation databases

BioMutaiCACNB3
DMDMi1705683

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001440561 – 484Voltage-dependent L-type calcium channel subunit beta-3Add BLAST484

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei152PhosphoserineBy similarity1
Modified residuei393PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiP54284
PaxDbiP54284
PeptideAtlasiP54284
PRIDEiP54284
ProteomicsDBi56673
56674 [P54284-2]

PTM databases

iPTMnetiP54284
PhosphoSitePlusiP54284

Expressioni

Tissue specificityi

Expressed mostly in brain, colon and ovary.1 Publication

Gene expression databases

BgeeiENSG00000167535 Expressed in 195 organ(s), highest expression level in right frontal lobe
CleanExiHS_CACNB3
ExpressionAtlasiP54284 baseline and differential
GenevisibleiP54284 HS

Organism-specific databases

HPAiHPA059515

Interactioni

Subunit structurei

Component of a calcium channel complex consisting of a pore-forming alpha subunit (CACNA1C) and the ancillary subunits CACNB3 and CACNA2D1 (PubMed:29742403). The channel complex contains alpha, beta, gamma and delta subunits in a 1:1:1:1 ratio (Probable). Interacts with CACNA2D4 (PubMed:12181424). Interacts with FASLG (PubMed:19807924). Interacts with CBARP; prevents the interaction of CACNB3 with the alpha subunit CACNA1C thereby negatively regulating the activity of the corresponding calcium channel (By similarity).By similarityCurated3 Publications

Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107238, 12 interactors
DIPiDIP-39138N
IntActiP54284, 11 interactors
STRINGi9606.ENSP00000301050

Chemistry databases

BindingDBiP54284

Structurei

3D structure databases

ProteinModelPortaliP54284
SMRiP54284
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini59 – 128SH3PROSITE-ProRule annotationAdd BLAST70

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni195 – 345Mediates interaction with the alpha subunitBy similarityAdd BLAST151

Sequence similaritiesi

Keywords - Domaini

SH3 domain

Phylogenomic databases

eggNOGiKOG3812 Eukaryota
ENOG410XRDI LUCA
GeneTreeiENSGT00390000002740
HOGENOMiHOG000230979
HOVERGENiHBG050765
InParanoidiP54284
KOiK04864
OMAiKQKQTEH
OrthoDBiEOG091G09C1
PhylomeDBiP54284
TreeFamiTF316195

Family and domain databases

CDDicd12042 SH3_CACNB3, 1 hit
InterProiView protein in InterPro
IPR035760 CACNB3_SH3
IPR008145 GK/Ca_channel_bsu
IPR027417 P-loop_NTPase
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR008079 VDCC_L_b3su
IPR000584 VDCC_L_bsu
PANTHERiPTHR11824 PTHR11824, 1 hit
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF12052 VGCC_beta4Aa_N, 1 hit
PRINTSiPR01626 LCACHANNELB
PR01696 LCACHANNELB3
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 9 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: P54284-1) [UniParc]FASTAAdd to basket
Also known as: 3A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYDDSYVPGF EDSEAGSADS YTSRPSLDSD VSLEEDRESA RREVESQAQQ
60 70 80 90 100
QLERAKHKPV AFAVRTNVSY CGVLDEECPV QGSGVNFEAK DFLHIKEKYS
110 120 130 140 150
NDWWIGRLVK EGGDIAFIPS PQRLESIRLK QEQKARRSGN PSSLSDIGNR
160 170 180 190 200
RSPPPSLAKQ KQKQAEHVPP YDVVPSMRPV VLVGPSLKGY EVTDMMQKAL
210 220 230 240 250
FDFLKHRFDG RISITRVTAD LSLAKRSVLN NPGKRTIIER SSARSSIAEV
260 270 280 290 300
QSEIERIFEL AKSLQLVVLD ADTINHPAQL AKTSLAPIIV FVKVSSPKVL
310 320 330 340 350
QRLIRSRGKS QMKHLTVQMM AYDKLVQCPP ESFDVILDEN QLEDACEHLA
360 370 380 390 400
EYLEVYWRAT HHPAPGPGLL GPPSAIPGLQ NQQLLGERGE EHSPLERDSL
410 420 430 440 450
MPSDEASESS RQAWTGSSQR SSRHLEEDYA DAYQDLYQPH RQHTSGLPSA
460 470 480
NGHDPQDRLL AQDSEHNHSD RNWQRNRPWP KDSY
Length:484
Mass (Da):54,532
Last modified:October 1, 1996 - v1
Checksum:i19CD3549F5A8E17A
GO
Isoform 2 (identifier: P54284-2) [UniParc]FASTAAdd to basket
Also known as: 3B

The sequence of this isoform differs from the canonical sequence as follows:
     440-484: HRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDSY → QCQLLSLL

Show »
Length:447
Mass (Da):50,106
Checksum:iC2BCB90B9B4FEB3F
GO
Isoform 3 (identifier: P54284-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MYDDSYVPGFEDSEA → ME

Note: No experimental confirmation available.
Show »
Length:471
Mass (Da):53,085
Checksum:i37BA075B29E7A52C
GO
Isoform 4 (identifier: P54284-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MYDDSYVPGFEDSEA → MSFSDSSATFLLNE

Note: No experimental confirmation available.
Show »
Length:483
Mass (Da):54,356
Checksum:iC979431C760076AF
GO
Isoform 5 (identifier: P54284-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     57-97: Missing.

Note: Gene prediction based on EST data.
Show »
Length:443
Mass (Da):50,015
Checksum:i6A689973F8712530
GO

Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VNV8F8VNV8_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
457Annotation score:
F8VV14F8VV14_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
151Annotation score:
F8VUW8F8VUW8_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
122Annotation score:
F8VWK1F8VWK1_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
144Annotation score:
F8VU10F8VU10_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
55Annotation score:
F8W0F8F8W0F8_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
105Annotation score:
H0YHK1H0YHK1_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
84Annotation score:
H0YHY2H0YHY2_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
76Annotation score:
F8W1N3F8W1N3_HUMAN
Voltage-dependent L-type calcium ch...
CACNB3
37Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti7V → L in AAA19799 (PubMed:8119293).Curated1
Sequence conflicti32Missing in AAA19799 (PubMed:8119293).Curated1
Sequence conflicti60V → E in AAA19799 (PubMed:8119293).Curated1
Sequence conflicti101N → D in BAH14694 (PubMed:14702039).Curated1
Sequence conflicti162Q → R in BAH14209 (PubMed:14702039).Curated1
Sequence conflicti196M → T in BAH12637 (PubMed:14702039).Curated1
Sequence conflicti245S → P in BAH12637 (PubMed:14702039).Curated1
Sequence conflicti320Missing in AAA19799 (PubMed:8119293).Curated1
Sequence conflicti348H → L in AAA19799 (PubMed:8119293).Curated1
Sequence conflicti421S → T in AAA19799 (PubMed:8119293).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024384423R → H. Corresponds to variant dbSNP:rs2229954Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0467081 – 15MYDDS…EDSEA → ME in isoform 3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_0467091 – 15MYDDS…EDSEA → MSFSDSSATFLLNE in isoform 4. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_04671057 – 97Missing in isoform 5. CuratedAdd BLAST41
Alternative sequenceiVSP_000634440 – 484HRQHT…PKDSY → QCQLLSLL in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X76555 mRNA Translation: CAA54055.1
X76556 mRNA Translation: CAA54056.1
D43704 Genomic DNA Translation: BAA07803.1
U07139 mRNA Translation: AAA95958.1
L27584 mRNA Translation: AAA19799.1
AK289709 mRNA Translation: BAF82398.1
AK297639 mRNA Translation: BAH12637.1
AK304537 mRNA Translation: BAH14209.1
AK316323 mRNA Translation: BAH14694.1
AC117498 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58008.1
BC041811 mRNA Translation: AAH41811.1
CCDSiCCDS55821.1 [P54284-3]
CCDS55822.1 [P54284-4]
CCDS55823.1 [P54284-5]
CCDS8769.1 [P54284-1]
PIRiS39315
S39316
S41211
RefSeqiNP_000716.2, NM_000725.3 [P54284-1]
NP_001193844.1, NM_001206915.1 [P54284-5]
NP_001193845.1, NM_001206916.1 [P54284-4]
NP_001193846.1, NM_001206917.1 [P54284-3]
UniGeneiHs.250712
Hs.737291

Genome annotation databases

EnsembliENST00000301050; ENSP00000301050; ENSG00000167535 [P54284-1]
ENST00000536187; ENSP00000444160; ENSG00000167535 [P54284-4]
ENST00000540990; ENSP00000445495; ENSG00000167535 [P54284-3]
ENST00000547230; ENSP00000448304; ENSG00000167535 [P54284-5]
GeneIDi784
KEGGihsa:784
UCSCiuc001rsl.3 human [P54284-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X76555 mRNA Translation: CAA54055.1
X76556 mRNA Translation: CAA54056.1
D43704 Genomic DNA Translation: BAA07803.1
U07139 mRNA Translation: AAA95958.1
L27584 mRNA Translation: AAA19799.1
AK289709 mRNA Translation: BAF82398.1
AK297639 mRNA Translation: BAH12637.1
AK304537 mRNA Translation: BAH14209.1
AK316323 mRNA Translation: BAH14694.1
AC117498 Genomic DNA No translation available.
CH471111 Genomic DNA Translation: EAW58008.1
BC041811 mRNA Translation: AAH41811.1
CCDSiCCDS55821.1 [P54284-3]
CCDS55822.1 [P54284-4]
CCDS55823.1 [P54284-5]
CCDS8769.1 [P54284-1]
PIRiS39315
S39316
S41211
RefSeqiNP_000716.2, NM_000725.3 [P54284-1]
NP_001193844.1, NM_001206915.1 [P54284-5]
NP_001193845.1, NM_001206916.1 [P54284-4]
NP_001193846.1, NM_001206917.1 [P54284-3]
UniGeneiHs.250712
Hs.737291

3D structure databases

ProteinModelPortaliP54284
SMRiP54284
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107238, 12 interactors
DIPiDIP-39138N
IntActiP54284, 11 interactors
STRINGi9606.ENSP00000301050

Chemistry databases

BindingDBiP54284
ChEMBLiCHEMBL3430901
DrugBankiDB04855 Dronedarone
DB01388 Mibefradil
DB00393 Nimodipine
DB00421 Spironolactone
DB00661 Verapamil

Protein family/group databases

TCDBi8.A.22.1.3 the ca(2+) channel auxiliary subunit Beta types 1-4 (cca-Beta) family

PTM databases

iPTMnetiP54284
PhosphoSitePlusiP54284

Polymorphism and mutation databases

BioMutaiCACNB3
DMDMi1705683

Proteomic databases

MaxQBiP54284
PaxDbiP54284
PeptideAtlasiP54284
PRIDEiP54284
ProteomicsDBi56673
56674 [P54284-2]

Protocols and materials databases

DNASUi784
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000301050; ENSP00000301050; ENSG00000167535 [P54284-1]
ENST00000536187; ENSP00000444160; ENSG00000167535 [P54284-4]
ENST00000540990; ENSP00000445495; ENSG00000167535 [P54284-3]
ENST00000547230; ENSP00000448304; ENSG00000167535 [P54284-5]
GeneIDi784
KEGGihsa:784
UCSCiuc001rsl.3 human [P54284-1]

Organism-specific databases

CTDi784
DisGeNETi784
EuPathDBiHostDB:ENSG00000167535.7
GeneCardsiCACNB3
HGNCiHGNC:1403 CACNB3
HPAiHPA059515
MIMi601958 gene
neXtProtiNX_P54284
OpenTargetsiENSG00000167535
PharmGKBiPA89
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3812 Eukaryota
ENOG410XRDI LUCA
GeneTreeiENSGT00390000002740
HOGENOMiHOG000230979
HOVERGENiHBG050765
InParanoidiP54284
KOiK04864
OMAiKQKQTEH
OrthoDBiEOG091G09C1
PhylomeDBiP54284
TreeFamiTF316195

Enzyme and pathway databases

ReactomeiR-HSA-112308 Presynaptic depolarization and calcium channel opening
R-HSA-400042 Adrenaline,noradrenaline inhibits insulin secretion
R-HSA-419037 NCAM1 interactions
R-HSA-422356 Regulation of insulin secretion
R-HSA-5576892 Phase 0 - rapid depolarisation
R-HSA-5576893 Phase 2 - plateau phase

Miscellaneous databases

ChiTaRSiCACNB3 human
GeneWikiiCACNB3
GenomeRNAii784
PROiPR:P54284
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000167535 Expressed in 195 organ(s), highest expression level in right frontal lobe
CleanExiHS_CACNB3
ExpressionAtlasiP54284 baseline and differential
GenevisibleiP54284 HS

Family and domain databases

CDDicd12042 SH3_CACNB3, 1 hit
InterProiView protein in InterPro
IPR035760 CACNB3_SH3
IPR008145 GK/Ca_channel_bsu
IPR027417 P-loop_NTPase
IPR036028 SH3-like_dom_sf
IPR001452 SH3_domain
IPR008079 VDCC_L_b3su
IPR000584 VDCC_L_bsu
PANTHERiPTHR11824 PTHR11824, 1 hit
PfamiView protein in Pfam
PF00625 Guanylate_kin, 1 hit
PF12052 VGCC_beta4Aa_N, 1 hit
PRINTSiPR01626 LCACHANNELB
PR01696 LCACHANNELB3
SMARTiView protein in SMART
SM00072 GuKc, 1 hit
SUPFAMiSSF50044 SSF50044, 1 hit
SSF52540 SSF52540, 1 hit
PROSITEiView protein in PROSITE
PS50002 SH3, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCACB3_HUMAN
AccessioniPrimary (citable) accession number: P54284
Secondary accession number(s): A8K0Z4
, B7Z4Q1, B7Z973, B7ZAK8, F5GZW7, F5H2P6, F8VSG3, Q13913
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: September 12, 2018
This is version 177 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again