Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LIM domain kinase 2

Gene

LIMK2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.2 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei360ATPPROSITE-ProRule annotation1
Active sitei451By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi337 – 345ATPPROSITE-ProRule annotation9

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

BRENDAi2.7.10.2 2681
ReactomeiR-HSA-3928662 EPHB-mediated forward signaling
R-HSA-416572 Sema4D induced cell migration and growth-cone collapse
R-HSA-5627117 RHO GTPases Activate ROCKs
SIGNORiP53671

Names & Taxonomyi

Protein namesi
Recommended name:
LIM domain kinase 2 (EC:2.7.11.1)
Short name:
LIMK-2
Gene namesi
Name:LIMK2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000182541.17
HGNCiHGNC:6614 LIMK2
MIMi601988 gene
neXtProtiNX_P53671

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi505T → E: Increases kinase activity. 1 Publication1
Mutagenesisi505T → V: Abolishes cofilin phosphorylation and enhancement of stress fiber formation. 1 Publication1

Organism-specific databases

DisGeNETi3985
OpenTargetsiENSG00000182541
PharmGKBiPA30387

Chemistry databases

ChEMBLiCHEMBL5932
GuidetoPHARMACOLOGYi2055

Polymorphism and mutation databases

BioMutaiLIMK2
DMDMi1708824

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000758091 – 638LIM domain kinase 2Add BLAST638

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei210PhosphothreonineCombined sources1
Modified residuei293PhosphoserineCombined sources1
Modified residuei298PhosphoserineCombined sources1
Modified residuei505Phosphothreonine; by ROCK1 and CDC42BP2 Publications1

Post-translational modificationi

Phosphorylated on serine and/or threonine residues by ROCK1.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiP53671
MaxQBiP53671
PaxDbiP53671
PeptideAtlasiP53671
PRIDEiP53671
ProteomicsDBi56602
56603 [P53671-2]
56604 [P53671-3]

PTM databases

iPTMnetiP53671
PhosphoSitePlusiP53671

Expressioni

Tissue specificityi

Highest expression in the placenta; moderate level in liver, lung, kidney, and pancreas. LIMK2a is found to be more abundant then LIMK2b in liver, colon, stomach, and spleen, while in brain, kidney, and placenta LIMK2b is the dominant form. In adult lung, both LIMK2a and LIMK2b is nearly equally observed.1 Publication

Gene expression databases

BgeeiENSG00000182541 Expressed in 220 organ(s), highest expression level in blood
CleanExiHS_LIMK2
ExpressionAtlasiP53671 baseline and differential
GenevisibleiP53671 HS

Organism-specific databases

HPAiCAB019313
HPA008183
HPA053882

Interactioni

Subunit structurei

Binds ROCK1 and MARF1 (Ref. 9, PubMed:11018042, PubMed:10436159). Interacts with PARD3. Interacts with NISCH (By similarity).By similarity3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
HSP90AB1P082382EBI-1384350,EBI-352572

GO - Molecular functioni

Protein-protein interaction databases

BioGridi110173, 37 interactors
IntActiP53671, 26 interactors
MINTiP53671
STRINGi9606.ENSP00000339916

Chemistry databases

BindingDBiP53671

Structurei

Secondary structure

1638
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP53671
SMRiP53671
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP53671

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini12 – 63LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST52
Domaini72 – 124LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST53
Domaini152 – 239PDZPROSITE-ProRule annotationAdd BLAST88
Domaini331 – 608Protein kinasePROSITE-ProRule annotationAdd BLAST278

Sequence similaritiesi

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiENOG410IEZ9 Eukaryota
COG0515 LUCA
GeneTreeiENSGT00530000063025
HOGENOMiHOG000013121
HOVERGENiHBG052328
InParanoidiP53671
KOiK05744
OMAiDARLSPH
OrthoDBiEOG091G03ZL
PhylomeDBiP53671
TreeFamiTF318014

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF00412 LIM, 2 hits
PF00595 PDZ, 1 hit
PF07714 Pkinase_Tyr, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 2 hits
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 2 hits
PS50106 PDZ, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform LIMK2a (identifier: P53671-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSALAGEDVW RCPGCGDHIA PSQIWYRTVN ETWHGSCFRC SECQDSLTNW
60 70 80 90 100
YYEKDGKLYC PKDYWGKFGE FCHGCSLLMT GPFMVAGEFK YHPECFACMS
110 120 130 140 150
CKVIIEDGDA YALVQHATLY CGKCHNEVVL APMFERLSTE SVQEQLPYSV
160 170 180 190 200
TLISMPATTE GRRGFSVSVE SACSNYATTV QVKEVNRMHI SPNNRNAIHP
210 220 230 240 250
GDRILEINGT PVRTLRVEEV EDAISQTSQT LQLLIEHDPV SQRLDQLRLE
260 270 280 290 300
ARLAPHMQNA GHPHALSTLD TKENLEGTLR RRSLRRSNSI SKSPGPSSPK
310 320 330 340 350
EPLLFSRDIS RSESLRCSSS YSQQIFRPCD LIHGEVLGKG FFGQAIKVTH
360 370 380 390 400
KATGKVMVMK ELIRCDEETQ KTFLTEVKVM RSLDHPNVLK FIGVLYKDKK
410 420 430 440 450
LNLLTEYIEG GTLKDFLRSM DPFPWQQKVR FAKGIASGMA YLHSMCIIHR
460 470 480 490 500
DLNSHNCLIK LDKTVVVADF GLSRLIVEER KRAPMEKATT KKRTLRKNDR
510 520 530 540 550
KKRYTVVGNP YWMAPEMLNG KSYDETVDIF SFGIVLCEII GQVYADPDCL
560 570 580 590 600
PRTLDFGLNV KLFWEKFVPT DCPPAFFPLA AICCRLEPES RPAFSKLEDS
610 620 630
FEALSLYLGE LGIPLPAELE ELDHTVSMQY GLTRDSPP
Length:638
Mass (Da):72,232
Last modified:October 1, 1996 - v1
Checksum:iFB51813D99AFAC18
GO
Isoform LIMK2b (identifier: P53671-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSC → MGSYLSVPAYFTSRDL

Show »
Length:617
Mass (Da):69,904
Checksum:i07449F035F01562C
GO
Isoform 3 (identifier: P53671-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MSALAGEDVWRCPGCGDHIAPSQIWYRTVNETWHGSC → MGSYLSVPAYFTSRDL
     592-638: PAFSKLEDSF...QYGLTRDSPP → APPGAAGEGP...MQKLSTPQKK

Note: No experimental confirmation available.
Show »
Length:686
Mass (Da):77,886
Checksum:i5BEF0CE326A851B5
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B5MC51B5MC51_HUMAN
LIM domain kinase 2
LIMK2
629Annotation score:
C9JK61C9JK61_HUMAN
LIM domain kinase 2
LIMK2
82Annotation score:

Sequence cautioni

The sequence AAB54055 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03406935G → S1 PublicationCorresponds to variant dbSNP:rs5997917Ensembl.1
Natural variantiVAR_04224945D → N1 PublicationCorresponds to variant dbSNP:rs35923988Ensembl.1
Natural variantiVAR_042250213R → C1 PublicationCorresponds to variant dbSNP:rs34930775Ensembl.1
Natural variantiVAR_042251296P → R1 PublicationCorresponds to variant dbSNP:rs34875793Ensembl.1
Natural variantiVAR_050149381R → H. Corresponds to variant dbSNP:rs2229874Ensembl.1
Natural variantiVAR_042252418R → C1 PublicationCorresponds to variant dbSNP:rs35422808Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0122871 – 37MSALA…WHGSC → MGSYLSVPAYFTSRDL in isoform LIMK2b and isoform 3. 3 PublicationsAdd BLAST37
Alternative sequenceiVSP_043332592 – 638PAFSK…RDSPP → APPGAAGEGPGCADDEGPVR RQGKVTIKYDPKELRKHLNL EEWILEQLTRLYDCQEEEIS ELEIDVDELLDMESDDAWAS RVKELLVDCYKPTEAFISGL LDKIRAMQKLSTPQKK in isoform 3. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D45906 mRNA Translation: BAA08312.1
D85527 mRNA Translation: BAA12827.1
AL117466 mRNA Translation: CAB55941.1
CR456513 mRNA Translation: CAG30399.1
AK291640 mRNA Translation: BAF84329.1
AC002073 Genomic DNA Translation: AAB54055.1 Sequence problems.
AC002073 Genomic DNA Translation: AAB54056.1
CH471095 Genomic DNA Translation: EAW59954.1
CH471095 Genomic DNA Translation: EAW59956.1
CH471095 Genomic DNA Translation: EAW59958.1
BC013051 mRNA Translation: AAH13051.1
CCDSiCCDS13891.1 [P53671-1]
CCDS13892.1 [P53671-2]
CCDS33637.1 [P53671-3]
PIRiA59196
RefSeqiNP_001026971.1, NM_001031801.1 [P53671-3]
NP_005560.1, NM_005569.3 [P53671-1]
NP_057952.1, NM_016733.2 [P53671-2]
UniGeneiHs.474596

Genome annotation databases

EnsembliENST00000331728; ENSP00000332687; ENSG00000182541 [P53671-1]
ENST00000333611; ENSP00000330470; ENSG00000182541 [P53671-2]
ENST00000340552; ENSP00000339916; ENSG00000182541 [P53671-3]
GeneIDi3985
KEGGihsa:3985
UCSCiuc003akh.4 human [P53671-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D45906 mRNA Translation: BAA08312.1
D85527 mRNA Translation: BAA12827.1
AL117466 mRNA Translation: CAB55941.1
CR456513 mRNA Translation: CAG30399.1
AK291640 mRNA Translation: BAF84329.1
AC002073 Genomic DNA Translation: AAB54055.1 Sequence problems.
AC002073 Genomic DNA Translation: AAB54056.1
CH471095 Genomic DNA Translation: EAW59954.1
CH471095 Genomic DNA Translation: EAW59956.1
CH471095 Genomic DNA Translation: EAW59958.1
BC013051 mRNA Translation: AAH13051.1
CCDSiCCDS13891.1 [P53671-1]
CCDS13892.1 [P53671-2]
CCDS33637.1 [P53671-3]
PIRiA59196
RefSeqiNP_001026971.1, NM_001031801.1 [P53671-3]
NP_005560.1, NM_005569.3 [P53671-1]
NP_057952.1, NM_016733.2 [P53671-2]
UniGeneiHs.474596

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1X6ANMR-A62-129[»]
4TPTX-ray2.60A/B330-632[»]
5NXDX-ray1.90A/B330-632[»]
ProteinModelPortaliP53671
SMRiP53671
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi110173, 37 interactors
IntActiP53671, 26 interactors
MINTiP53671
STRINGi9606.ENSP00000339916

Chemistry databases

BindingDBiP53671
ChEMBLiCHEMBL5932
GuidetoPHARMACOLOGYi2055

PTM databases

iPTMnetiP53671
PhosphoSitePlusiP53671

Polymorphism and mutation databases

BioMutaiLIMK2
DMDMi1708824

Proteomic databases

EPDiP53671
MaxQBiP53671
PaxDbiP53671
PeptideAtlasiP53671
PRIDEiP53671
ProteomicsDBi56602
56603 [P53671-2]
56604 [P53671-3]

Protocols and materials databases

DNASUi3985
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000331728; ENSP00000332687; ENSG00000182541 [P53671-1]
ENST00000333611; ENSP00000330470; ENSG00000182541 [P53671-2]
ENST00000340552; ENSP00000339916; ENSG00000182541 [P53671-3]
GeneIDi3985
KEGGihsa:3985
UCSCiuc003akh.4 human [P53671-1]

Organism-specific databases

CTDi3985
DisGeNETi3985
EuPathDBiHostDB:ENSG00000182541.17
GeneCardsiLIMK2
HGNCiHGNC:6614 LIMK2
HPAiCAB019313
HPA008183
HPA053882
MIMi601988 gene
neXtProtiNX_P53671
OpenTargetsiENSG00000182541
PharmGKBiPA30387
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEZ9 Eukaryota
COG0515 LUCA
GeneTreeiENSGT00530000063025
HOGENOMiHOG000013121
HOVERGENiHBG052328
InParanoidiP53671
KOiK05744
OMAiDARLSPH
OrthoDBiEOG091G03ZL
PhylomeDBiP53671
TreeFamiTF318014

Enzyme and pathway databases

BRENDAi2.7.10.2 2681
ReactomeiR-HSA-3928662 EPHB-mediated forward signaling
R-HSA-416572 Sema4D induced cell migration and growth-cone collapse
R-HSA-5627117 RHO GTPases Activate ROCKs
SIGNORiP53671

Miscellaneous databases

ChiTaRSiLIMK2 human
EvolutionaryTraceiP53671
GeneWikiiLIMK2
GenomeRNAii3985
PROiPR:P53671
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000182541 Expressed in 220 organ(s), highest expression level in blood
CleanExiHS_LIMK2
ExpressionAtlasiP53671 baseline and differential
GenevisibleiP53671 HS

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR001478 PDZ
IPR036034 PDZ_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR001245 Ser-Thr/Tyr_kinase_cat_dom
IPR001781 Znf_LIM
PfamiView protein in Pfam
PF00412 LIM, 2 hits
PF00595 PDZ, 1 hit
PF07714 Pkinase_Tyr, 1 hit
SMARTiView protein in SMART
SM00132 LIM, 2 hits
SM00228 PDZ, 1 hit
SUPFAMiSSF50156 SSF50156, 1 hit
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00478 LIM_DOMAIN_1, 2 hits
PS50023 LIM_DOMAIN_2, 2 hits
PS50106 PDZ, 1 hit
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiLIMK2_HUMAN
AccessioniPrimary (citable) accession number: P53671
Secondary accession number(s): A8K6H5
, Q7KZ80, Q7L3H5, Q96E10, Q99464, Q9UFU0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: September 12, 2018
This is version 188 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  3. SIMILARITY comments
    Index of protein domains and families
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  6. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  7. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again