Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P53670 (LIMK2_RAT)

Entry version 161 (12 Aug 2020)
Sequence version 1 (01 Oct 1996)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

LIM domain kinase 2

Gene

Limk2

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine-protein kinase that plays an essential role in the regulation of actin filament dynamics. Acts downstream of several Rho family GTPase signal transduction pathways. Involved in astral microtubule organization and mitotic spindle orientation during early stage of mitosis by mediating phosphorylation of TPPP. Displays serine/threonine-specific phosphorylation of myelin basic protein and histone (MBP) in vitro.By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei360ATPPROSITE-ProRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei451By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi337 – 345ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
LigandATP-binding, Metal-binding, Nucleotide-binding, Zinc

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		2.7.10.2, 5301

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
LIM domain kinase 2 (EC:2.7.11.1By similarity)
Short name:
LIMK-2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Limk2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiRattus norvegicus (Rat)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10116 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Rattus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000002494 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Rat genome database

More...RGDi		62056, Limk2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000758111 – 638LIM domain kinase 2Add BLAST638

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei210PhosphothreonineBy similarity1
Modified residuei293PhosphoserineBy similarity1
Modified residuei298PhosphoserineBy similarity1
Modified residuei505Phosphothreonine; by ROCK1 and CDC42BPBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated on serine and/or threonine residues by ROCK1.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P53670

PRoteomics IDEntifications database

More...PRIDEi		P53670

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P53670

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P53670

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Found in various tissues at moderate levels, except for testis, which shows very low expression.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSRNOG00000019000, Expressed in brain and 22 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P53670, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P53670, RN

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds ROCK1 and MARF1 (By similarity).

Interacts with NISCH (By similarity).

By similarity

Protein-protein interaction databases

Protein interaction database and analysis system

More...IntActi		P53670, 1 interactor

STRING: functional protein association networks

More...STRINGi		10116.ENSRNOP00000026032

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P53670

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini12 – 63LIM zinc-binding 1PROSITE-ProRule annotationAdd BLAST52
Domaini72 – 124LIM zinc-binding 2PROSITE-ProRule annotationAdd BLAST53
Domaini152 – 239PDZPROSITE-ProRule annotationAdd BLAST88
Domaini331 – 608Protein kinasePROSITE-ProRule annotationAdd BLAST278

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.Curated

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1187, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159133

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_110071_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P53670

KEGG Orthology (KO)

More...KOi		K05744

Identification of Orthologs from Complete Genome Data

More...OMAi		NCYCAGC

Database of Orthologous Groups

More...OrthoDBi		988822at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P53670

TreeFam database of animal gene trees

More...TreeFami		TF318014

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.30.42.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011009, Kinase-like_dom_sf
IPR001478, PDZ
IPR036034, PDZ_sf
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR001245, Ser-Thr/Tyr_kinase_cat_dom
IPR001781, Znf_LIM

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00412, LIM, 2 hits
PF00595, PDZ, 1 hit
PF07714, Pkinase_Tyr, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00132, LIM, 2 hits
SM00228, PDZ, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF50156, SSF50156, 1 hit
SSF56112, SSF56112, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00478, LIM_DOMAIN_1, 2 hits
PS50023, LIM_DOMAIN_2, 2 hits
PS50106, PDZ, 1 hit
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform LIMK2A (identifier: P53670-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAALAGEEAW RCRGCGNYVP LSQRLYRTAN EAWHSSCFRC SECQESLTNW 
        60         70         80         90        100
YYEKDGKLYC HKDYWAKFGE FCHGCSLLMT GPAMVAGEFK YHPECFACMS 
       110        120        130        140        150
CKVIIEDGDA YALVQHATLY CGKCHNEVVL APMFERLSTE SVQDQLPYSV 
       160        170        180        190        200
TLISMPATTE CRRGFSVSVE SASSNYATTV QVKEVNRMHI SPNNRNAIHP 
       210        220        230        240        250
GDRILEINGT PVRTLRVEEV EDAINQTSQT LQLLIEHDPV PQRLDQLRLD 
       260        270        280        290        300
TRLSPHMQSS GHTLMLSTLD AKENQEGTLR RRSLRRSNSI SKSPGPSSPK 
       310        320        330        340        350
EPLLLSRDIS RSESLRCSSS YSQQIFRPCD LIHGEVLGKG FFGQAIKVTH 
       360        370        380        390        400
KATGKVMVMK ELIRCDEETQ KTFLTEVKVM RSLDHPNVLK FIGVLYKDKK 
       410        420        430        440        450
LNLLTEYIEG GTLKDFLRNV DPFPWQQKVR FAKGIASGMA YLHSMCIIHR 
       460        470        480        490        500
DLNSHNCLIK LDKTVVVADF GLSRLIVEER KRPPVEKAAT KKRTLRKSDR 
       510        520        530        540        550
KKRYTVVGNP YWMAPEMLNG KSYDETVDVF SFGIVLCEII GQVYADPDCL 
       560        570        580        590        600
PRTLDFGLNV KLFWEKFVPT DCPPAFFPLA AICCKLEPES RPAFSKLEDS 
       610        620        630 
FEALSLFLGE LAIPLPAELE ELDHTVSMEY GLTRDSPP
Length:638
Mass (Da):72,202
Last modified:October 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iA7E2D525751BE4F3
GO
Isoform LIMK2B (identifier: P53670-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MAALAGEEAWRCRGCGNYVPLSQRLYRTANEAWHSSC → MGSYLSVPAYFTSRDP

Show »
Length:617
Mass (Da):69,834
Checksum:iFE981C7C8A54B845
GO
Isoform LIMK2C (identifier: P53670-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MAALAGEEAWRCRGCGNYVPLSQRLYRTANEAWHSSC → MGSYLSVPAYFTSRDP
     348-371: VTHKATGKVMVMKELIRCDEETQK → SWEGGSGDSQSHRQSDGHEGVNSL
     372-638: Missing.

Show »
Length:350
Mass (Da):39,184
Checksum:i31EB7E8D2FC48A60
GO
Isoform LIMK2D (identifier: P53670-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MAALAGEEAWRCRGCGNYVPLSQRLYRTANEAWHSSC → MGSYLSVPAYFTSRDP
     185-638: Missing.

Show »
Length:163
Mass (Da):18,353
Checksum:i51460FE0D2C5D615
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0031281 – 37MAALA…WHSSC → MGSYLSVPAYFTSRDP in isoform LIMK2B, isoform LIMK2C and isoform LIMK2D. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_003131185 – 638Missing in isoform LIMK2D. 1 PublicationAdd BLAST454
Alternative sequenceiVSP_003129348 – 371VTHKA…EETQK → SWEGGSGDSQSHRQSDGHEG VNSL in isoform LIMK2C. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_003130372 – 638Missing in isoform LIMK2C. 1 PublicationAdd BLAST267

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
D31874 mRNA Translation: BAA06673.1
D31875 mRNA Translation: BAA06674.1
D31876 mRNA Translation: BAA06675.1
D31877 mRNA Translation: BAA06676.1

Protein sequence database of the Protein Information Resource

More...PIRi		I78846
I78847
I78848

NCBI Reference Sequences

More...RefSeqi		NP_077049.2, NM_024135.2 [P53670-1]
XP_006251298.1, XM_006251236.3 [P53670-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENSRNOT00000026032; ENSRNOP00000026032; ENSRNOG00000019000 [P53670-1]
ENSRNOT00000050005; ENSRNOP00000044951; ENSRNOG00000019000 [P53670-2]
ENSRNOT00000057673; ENSRNOP00000054482; ENSRNOG00000019000 [P53670-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		29524

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		rno:29524

UCSC genome browser

More...UCSCi		RGD:62056, rat [P53670-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D31874 mRNA Translation: BAA06673.1
D31875 mRNA Translation: BAA06674.1
D31876 mRNA Translation: BAA06675.1
D31877 mRNA Translation: BAA06676.1
PIRiI78846
I78847
I78848
RefSeqiNP_077049.2, NM_024135.2 [P53670-1]
XP_006251298.1, XM_006251236.3 [P53670-2]

3D structure databases

SMRiP53670
ModBaseiSearch...

Protein-protein interaction databases

IntActiP53670, 1 interactor
STRINGi10116.ENSRNOP00000026032

PTM databases

iPTMnetiP53670
PhosphoSitePlusiP53670

Proteomic databases

PaxDbiP53670
PRIDEiP53670

Genome annotation databases

EnsembliENSRNOT00000026032; ENSRNOP00000026032; ENSRNOG00000019000 [P53670-1]
ENSRNOT00000050005; ENSRNOP00000044951; ENSRNOG00000019000 [P53670-2]
ENSRNOT00000057673; ENSRNOP00000054482; ENSRNOG00000019000 [P53670-4]
GeneIDi29524
KEGGirno:29524
UCSCiRGD:62056, rat [P53670-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		3985
RGDi62056, Limk2

Phylogenomic databases

eggNOGiKOG1187, Eukaryota
GeneTreeiENSGT00940000159133
HOGENOMiCLU_110071_0_0_1
InParanoidiP53670
KOiK05744
OMAiNCYCAGC
OrthoDBi988822at2759
PhylomeDBiP53670
TreeFamiTF318014

Enzyme and pathway databases

BRENDAi2.7.10.2, 5301

Miscellaneous databases

Protein Ontology

More...PROi		PR:P53670

Gene expression databases

BgeeiENSRNOG00000019000, Expressed in brain and 22 other tissues
ExpressionAtlasiP53670, baseline and differential
GenevisibleiP53670, RN

Family and domain databases

Gene3Di2.30.42.10, 1 hit
InterProiView protein in InterPro
IPR011009, Kinase-like_dom_sf
IPR001478, PDZ
IPR036034, PDZ_sf
IPR000719, Prot_kinase_dom
IPR017441, Protein_kinase_ATP_BS
IPR001245, Ser-Thr/Tyr_kinase_cat_dom
IPR001781, Znf_LIM
PfamiView protein in Pfam
PF00412, LIM, 2 hits
PF00595, PDZ, 1 hit
PF07714, Pkinase_Tyr, 1 hit
SMARTiView protein in SMART
SM00132, LIM, 2 hits
SM00228, PDZ, 1 hit
SUPFAMiSSF50156, SSF50156, 1 hit
SSF56112, SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00478, LIM_DOMAIN_1, 2 hits
PS50023, LIM_DOMAIN_2, 2 hits
PS50106, PDZ, 1 hit
PS00107, PROTEIN_KINASE_ATP, 1 hit
PS50011, PROTEIN_KINASE_DOM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLIMK2_RAT
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P53670
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: August 12, 2020
This is version 161 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again