Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dipeptidyl peptidase 1

Gene

CTSC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Thiol protease. Has dipeptidylpeptidase activity. Active against a broad range of dipeptide substrates composed of both polar and hydrophobic amino acids. Proline cannot occupy the P1 position and arginine cannot occupy the P2 position of the substrate. Can act as both an exopeptidase and endopeptidase. Activates serine proteases such as elastase, cathepsin G and granzymes A and B. Can also activate neuraminidase and factor XIII.1 Publication

Catalytic activityi

Release of an N-terminal dipeptide, Xaa-Yaa-|-Zaa-, except when Xaa is Arg or Lys, or Yaa or Zaa is Pro.

Cofactori

chlorideNote: Binds 1 Cl- ion per heavy chain.

Activity regulationi

Strongly inhibited by the cysteine peptidase inhibitors mersalyl acid, iodoacetic acid and cystatin. Inhibited by N-ethylmaleimide, Gly-Phe-diazomethane, TLCK, TPCK and, at low pH, by dithiodipyridine. Not inhibited by the serine peptidase inhibitor PMSF, the aminopeptidase inhibitor bestatin, or metal ion chelators.1 Publication

pH dependencei

High activity at pH 4.5-6.8.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei2581
Binding sitei302Chloride1
Binding sitei304Chloride; via amide nitrogen1
Binding sitei347Chloride1
Active sitei4051
Active sitei4271

GO - Molecular functioni

  • chaperone binding Source: BHF-UCL
  • chloride ion binding Source: Ensembl
  • cysteine-type endopeptidase activity Source: GO_Central
  • cysteine-type peptidase activity Source: UniProtKB
  • identical protein binding Source: Ensembl
  • peptidase activator activity involved in apoptotic process Source: Ensembl
  • phosphatase binding Source: BHF-UCL
  • protein self-association Source: Ensembl
  • serine-type endopeptidase activity Source: Ensembl

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
LigandChloride

Enzyme and pathway databases

BioCyciMetaCyc:HS03265-MONOMER
BRENDAi3.4.14.1 2681
ReactomeiR-HSA-204005 COPII-mediated vesicle transport
R-HSA-2132295 MHC class II antigen presentation
R-HSA-5694530 Cargo concentration in the ER
R-HSA-6798695 Neutrophil degranulation
SABIO-RKiP53634

Protein family/group databases

MEROPSiC01.070

Names & Taxonomyi

Protein namesi
Recommended name:
Dipeptidyl peptidase 1 (EC:3.4.14.1)
Alternative name(s):
Cathepsin C
Cathepsin J
Dipeptidyl peptidase I
Short name:
DPP-I
Short name:
DPPI
Dipeptidyl transferase
Cleaved into the following 3 chains:
Alternative name(s):
Dipeptidyl peptidase I exclusion domain chain
Alternative name(s):
Dipeptidyl peptidase I heavy chain
Alternative name(s):
Dipeptidyl peptidase I light chain
Gene namesi
Name:CTSC
Synonyms:CPPI
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000109861.15
HGNCiHGNC:2528 CTSC
MIMi602365 gene
neXtProtiNX_P53634

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Lysosome

Pathology & Biotechi

Involvement in diseasei

Papillon-Lefevre syndrome (PLS)13 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disorder characterized by palmoplantar keratosis and severe periodontitis affecting deciduous and permanent dentitions and resulting in premature tooth loss. The palmoplantar keratotic phenotype vary from mild psoriasiform scaly skin to overt hyperkeratosis. Keratosis also affects other sites such as elbows and knees.
See also OMIM:245000
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01693339W → S in PLS. 1 PublicationCorresponds to variant dbSNP:rs104894210EnsemblClinVar.1
Natural variantiVAR_01903567 – 74Missing in PLS. 1 Publication8
Natural variantiVAR_016934127H → P in PLS. 1 PublicationCorresponds to variant dbSNP:rs104894216EnsemblClinVar.1
Natural variantiVAR_019036129V → E in PLS. 1 PublicationCorresponds to variant dbSNP:rs760130711Ensembl.1
Natural variantiVAR_019037139G → R in PLS. 2 PublicationsCorresponds to variant dbSNP:rs749103588Ensembl.1
Natural variantiVAR_019038236D → Y in PLS. 2 PublicationsCorresponds to variant dbSNP:rs764724707Ensembl.1
Natural variantiVAR_009541249V → F in PLS. 2 Publications1
Natural variantiVAR_009542252Q → L in PLS. 2 PublicationsCorresponds to variant dbSNP:rs104894207EnsemblClinVar.1
Natural variantiVAR_019039272R → H in PLS. 1 PublicationCorresponds to variant dbSNP:rs587777534EnsemblClinVar.1
Natural variantiVAR_009543272R → P in PLS. 5 PublicationsCorresponds to variant dbSNP:rs587777534EnsemblClinVar.1
Natural variantiVAR_019040291C → Y in PLS. 1 PublicationCorresponds to variant dbSNP:rs748729285EnsemblClinVar.1
Natural variantiVAR_039686294Y → H in PLS. 1 Publication1
Natural variantiVAR_019041300G → D in PLS. 2 Publications1
Natural variantiVAR_019042300G → S in PLS. 1 Publication1
Natural variantiVAR_009544301G → S in PLS. 4 PublicationsCorresponds to variant dbSNP:rs104894214EnsemblClinVar.1
Natural variantiVAR_019043301G → V in PLS. 1 Publication1
Natural variantiVAR_019044304Y → N in PLS. 1 Publication1
Natural variantiVAR_019045312Q → R in PLS. 1 Publication1
Natural variantiVAR_019046319E → G in PLS. 1 Publication1
Natural variantiVAR_009545339R → C in PLS. 5 PublicationsCorresponds to variant dbSNP:rs1044703733Ensembl.1
Natural variantiVAR_016944340Y → C in PLS. 2 Publications1
Natural variantiVAR_027249405H → N in PLS. 1 Publication1
Natural variantiVAR_027250405H → R in PLS. 1 PublicationCorresponds to variant dbSNP:rs151269219Ensembl.1
Natural variantiVAR_016936429W → C in PLS. 1 PublicationCorresponds to variant dbSNP:rs104894215EnsemblClinVar.1
Natural variantiVAR_019048447E → G in PLS. 2 Publications1
Haim-Munk syndrome (HMS)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disorder characterized by palmoplantar keratosis, onychogryphosis and periodontitis. Additional features are pes planus, arachnodactyly, and acroosteolysis.
See also OMIM:245010
Periodontititis, aggressive, 1 (AP1)2 Publications
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disease characterized by severe and protracted gingival infections, generalized or localized, leading to tooth loss. Amounts of microbial deposits are generally inconsistent with the severity of periodontal tissue destruction and the progression of attachment and bone loss may be self arresting.
See also OMIM:170650
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_019047412Y → C in AP1. 1 PublicationCorresponds to variant dbSNP:rs28937571EnsemblClinVar.1

Keywords - Diseasei

Disease mutation, Palmoplantar keratoderma

Organism-specific databases

DisGeNETi1075
MalaCardsiCTSC
MIMi170650 phenotype
245000 phenotype
245010 phenotype
OpenTargetsiENSG00000109861
Orphaneti2342 Haim-Munk syndrome
678 Papillon-Lefevre syndrome
PharmGKBiPA27028

Chemistry databases

ChEMBLiCHEMBL2252
GuidetoPHARMACOLOGYi2344

Polymorphism and mutation databases

BioMutaiCTSC
DMDMi317373330

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 243 PublicationsAdd BLAST24
ChainiPRO_000002633825 – 134Dipeptidyl peptidase 1 exclusion domain chainAdd BLAST110
PropeptideiPRO_0000026339135 – 2303 PublicationsAdd BLAST96
ChainiPRO_0000026340231 – 394Dipeptidyl peptidase 1 heavy chainAdd BLAST164
ChainiPRO_0000026341395 – 463Dipeptidyl peptidase 1 light chainAdd BLAST69

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi29N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi30 ↔ 118
Glycosylationi53N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi54 ↔ 136
Glycosylationi119N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi255 ↔ 298
Glycosylationi276N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi291 ↔ 331
Disulfide bondi321 ↔ 337

Post-translational modificationi

N-glycosylated. While glycosylation at Asn-53, Asn-119 and Asn-276 is mediated by STT3A-containing complexes, glycosylation at Asn-29 is mediated STT3B-containing complexes.5 Publications
In approximately 50% of the complexes the exclusion domain is cleaved at position 58 or 61. The two parts of the exclusion domain are held together by a disulfide bond.

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

EPDiP53634
MaxQBiP53634
PaxDbiP53634
PeptideAtlasiP53634
PRIDEiP53634
ProteomicsDBi56595
56596 [P53634-2]
56597 [P53634-3]
TopDownProteomicsiP53634-1 [P53634-1]

PTM databases

GlyConnecti1175
iPTMnetiP53634
PhosphoSitePlusiP53634
SwissPalmiP53634

Miscellaneous databases

PMAP-CutDBiP53634

Expressioni

Tissue specificityi

Ubiquitous. Highly expressed in lung, kidney and placenta. Detected at intermediate levels in colon, small intestine, spleen and pancreas.1 Publication

Inductioni

Up-regulated in lymphocytes by IL2/interleukin-2.1 Publication

Gene expression databases

BgeeiENSG00000109861 Expressed in 221 organ(s), highest expression level in palpebral conjunctiva
ExpressionAtlasiP53634 baseline and differential
GenevisibleiP53634 HS

Organism-specific databases

HPAiCAB025364
HPA066610
HPA068434

Interactioni

Subunit structurei

Tetramer of heterotrimers consisting of exclusion domain, heavy- and light chains.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CST7O760962EBI-1047323,EBI-2807448

GO - Molecular functioni

Protein-protein interaction databases

BioGridi107502, 25 interactors
IntActiP53634, 22 interactors
MINTiP53634
STRINGi9606.ENSP00000227266

Chemistry databases

BindingDBiP53634

Structurei

Secondary structure

1463
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP53634
SMRiP53634
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP53634

Family & Domainsi

Sequence similaritiesi

Belongs to the peptidase C1 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG1543 Eukaryota
COG4870 LUCA
GeneTreeiENSGT00900000140859
HOGENOMiHOG000127503
HOVERGENiHBG066812
InParanoidiP53634
KOiK01275
OMAiFVTPVRN
OrthoDBiEOG091G06TT
PhylomeDBiP53634
TreeFamiTF313225

Family and domain databases

CDDicd02621 Peptidase_C1A_CathepsinC, 1 hit
Gene3Di2.40.128.80, 1 hit
InterProiView protein in InterPro
IPR039412 CatC
IPR014882 CathepsinC_exc
IPR036496 CathepsinC_exc_dom_sf
IPR038765 Papain_like_cys_pep_sf
IPR025661 Pept_asp_AS
IPR000169 Pept_cys_AS
IPR025660 Pept_his_AS
IPR013128 Peptidase_C1A
IPR000668 Peptidase_C1A_C
PANTHERiPTHR12411 PTHR12411, 1 hit
PfamiView protein in Pfam
PF08773 CathepsinC_exc, 1 hit
PF00112 Peptidase_C1, 1 hit
PRINTSiPR00705 PAPAIN
SMARTiView protein in SMART
SM00645 Pept_C1, 1 hit
SUPFAMiSSF54001 SSF54001, 1 hit
SSF75001 SSF75001, 1 hit
PROSITEiView protein in PROSITE
PS00640 THIOL_PROTEASE_ASN, 1 hit
PS00139 THIOL_PROTEASE_CYS, 1 hit
PS00639 THIOL_PROTEASE_HIS, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P53634-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAGPSLLLA ALLLLLSGDG AVRCDTPANC TYLDLLGTWV FQVGSSGSQR
60 70 80 90 100
DVNCSVMGPQ EKKVVVYLQK LDTAYDDLGN SGHFTIIYNQ GFEIVLNDYK
110 120 130 140 150
WFAFFKYKEE GSKVTTYCNE TMTGWVHDVL GRNWACFTGK KVGTASENVY
160 170 180 190 200
VNIAHLKNSQ EKYSNRLYKY DHNFVKAINA IQKSWTATTY MEYETLTLGD
210 220 230 240 250
MIRRSGGHSR KIPRPKPAPL TAEIQQKILH LPTSWDWRNV HGINFVSPVR
260 270 280 290 300
NQASCGSCYS FASMGMLEAR IRILTNNSQT PILSPQEVVS CSQYAQGCEG
310 320 330 340 350
GFPYLIAGKY AQDFGLVEEA CFPYTGTDSP CKMKEDCFRY YSSEYHYVGG
360 370 380 390 400
FYGGCNEALM KLELVHHGPM AVAFEVYDDF LHYKKGIYHH TGLRDPFNPF
410 420 430 440 450
ELTNHAVLLV GYGTDSASGM DYWIVKNSWG TGWGENGYFR IRRGTDECAI
460
ESIAVAATPI PKL
Length:463
Mass (Da):51,854
Last modified:January 11, 2011 - v2
Checksum:i4C9C7C24D900CEE6
GO
Isoform 2 (identifier: P53634-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     107-137: YKEEGSKVTTYCNETMTGWVHDVLGRNWACF → DVTDFISHLFMQLGTVGIYDLPHLRNKLVIK
     138-463: Missing.

Show »
Length:137
Mass (Da):15,169
Checksum:iC68FC076FCB30601
GO
Isoform 3 (identifier: P53634-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     107-141: YKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKK → DVTDFISHLFMQLGTVGIYDLPHLRNKLAMNRRWG
     142-463: Missing.

Note: No experimental confirmation available.
Show »
Length:141
Mass (Da):15,700
Checksum:iFAD4B1B511F91F66
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YCY8H0YCY8_HUMAN
Dipeptidyl peptidase 1
CTSC
244Annotation score:
H0YDA2H0YDA2_HUMAN
Dipeptidyl peptidase 1
CTSC
36Annotation score:

Sequence cautioni

The sequence CAD97897 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti63K → I in BAD96758 (Ref. 6) Curated1
Sequence conflicti237W → V AA sequence (PubMed:1586157).Curated1
Sequence conflicti321C → S AA sequence (PubMed:1586157).Curated1
Sequence conflicti355C → M AA sequence (PubMed:1586157).Curated1
Sequence conflicti366H → R AA sequence (PubMed:1586157).Curated1
Sequence conflicti376 – 378VYD → YVY AA sequence (PubMed:1586157).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01693339W → S in PLS. 1 PublicationCorresponds to variant dbSNP:rs104894210EnsemblClinVar.1
Natural variantiVAR_01903567 – 74Missing in PLS. 1 Publication8
Natural variantiVAR_016934127H → P in PLS. 1 PublicationCorresponds to variant dbSNP:rs104894216EnsemblClinVar.1
Natural variantiVAR_019036129V → E in PLS. 1 PublicationCorresponds to variant dbSNP:rs760130711Ensembl.1
Natural variantiVAR_019037139G → R in PLS. 2 PublicationsCorresponds to variant dbSNP:rs749103588Ensembl.1
Natural variantiVAR_016943153I → T12 PublicationsCorresponds to variant dbSNP:rs217086Ensembl.1
Natural variantiVAR_019038236D → Y in PLS. 2 PublicationsCorresponds to variant dbSNP:rs764724707Ensembl.1
Natural variantiVAR_009541249V → F in PLS. 2 Publications1
Natural variantiVAR_009542252Q → L in PLS. 2 PublicationsCorresponds to variant dbSNP:rs104894207EnsemblClinVar.1
Natural variantiVAR_019039272R → H in PLS. 1 PublicationCorresponds to variant dbSNP:rs587777534EnsemblClinVar.1
Natural variantiVAR_009543272R → P in PLS. 5 PublicationsCorresponds to variant dbSNP:rs587777534EnsemblClinVar.1
Natural variantiVAR_016935286Q → R in HMS and PLS. 2 PublicationsCorresponds to variant dbSNP:rs104894208EnsemblClinVar.1
Natural variantiVAR_019040291C → Y in PLS. 1 PublicationCorresponds to variant dbSNP:rs748729285EnsemblClinVar.1
Natural variantiVAR_039686294Y → H in PLS. 1 Publication1
Natural variantiVAR_019041300G → D in PLS. 2 Publications1
Natural variantiVAR_019042300G → S in PLS. 1 Publication1
Natural variantiVAR_009544301G → S in PLS. 4 PublicationsCorresponds to variant dbSNP:rs104894214EnsemblClinVar.1
Natural variantiVAR_019043301G → V in PLS. 1 Publication1
Natural variantiVAR_019044304Y → N in PLS. 1 Publication1
Natural variantiVAR_019045312Q → R in PLS. 1 Publication1
Natural variantiVAR_019046319E → G in PLS. 1 Publication1
Natural variantiVAR_009545339R → C in PLS. 5 PublicationsCorresponds to variant dbSNP:rs1044703733Ensembl.1
Natural variantiVAR_016944340Y → C in PLS. 2 Publications1
Natural variantiVAR_009546347Y → C in PLS and AP1. 3 PublicationsCorresponds to variant dbSNP:rs104894211EnsemblClinVar.1
Natural variantiVAR_016945401E → K1 PublicationCorresponds to variant dbSNP:rs200627023Ensembl.1
Natural variantiVAR_027249405H → N in PLS. 1 Publication1
Natural variantiVAR_027250405H → R in PLS. 1 PublicationCorresponds to variant dbSNP:rs151269219Ensembl.1
Natural variantiVAR_019047412Y → C in AP1. 1 PublicationCorresponds to variant dbSNP:rs28937571EnsemblClinVar.1
Natural variantiVAR_016936429W → C in PLS. 1 PublicationCorresponds to variant dbSNP:rs104894215EnsemblClinVar.1
Natural variantiVAR_019048447E → G in PLS. 2 Publications1
Natural variantiVAR_016946453I → V Rare polymorphism. 1 PublicationCorresponds to variant dbSNP:rs3888798EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_043232107 – 141YKEEG…FTGKK → DVTDFISHLFMQLGTVGIYD LPHLRNKLAMNRRWG in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_039123107 – 137YKEEG…NWACF → DVTDFISHLFMQLGTVGIYD LPHLRNKLVIK in isoform 2. 3 PublicationsAdd BLAST31
Alternative sequenceiVSP_039124138 – 463Missing in isoform 2. 3 PublicationsAdd BLAST326
Alternative sequenceiVSP_043233142 – 463Missing in isoform 3. 1 PublicationAdd BLAST322

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X87212 mRNA Translation: CAA60671.1
U79415 Genomic DNA Translation: AAC51341.1
AF234263 mRNA Translation: AAL48191.1
AF234264 mRNA Translation: AAL48192.1
AF254757 mRNA Translation: AAL48195.1
AF525032 mRNA Translation: AAQ08887.1
AF525033 mRNA Translation: AAQ08888.1
AK292117 mRNA Translation: BAF84806.1
AK311923 mRNA Translation: BAG34864.1
AK223038 mRNA Translation: BAD96758.1
BX537913 mRNA Translation: CAD97897.1 Different initiation.
AC011088 Genomic DNA No translation available.
CH471185 Genomic DNA Translation: EAW59364.1
BC054028 mRNA Translation: AAH54028.1
BC100891 mRNA Translation: AAI00892.1
BC100892 mRNA Translation: AAI00893.1
BC100893 mRNA Translation: AAI00894.1
BC100894 mRNA Translation: AAI00895.1
BC109386 mRNA Translation: AAI09387.1
BC110071 mRNA Translation: AAI10072.1
BC113850 mRNA Translation: AAI13851.1
BC113897 mRNA Translation: AAI13898.1
CCDSiCCDS31654.1 [P53634-2]
CCDS44693.1 [P53634-3]
CCDS8282.1 [P53634-1]
PIRiS23941
S66504
RefSeqiNP_001107645.1, NM_001114173.2 [P53634-3]
NP_001805.3, NM_001814.5
NP_680475.1, NM_148170.4 [P53634-2]
UniGeneiHs.128065

Genome annotation databases

EnsembliENST00000227266; ENSP00000227266; ENSG00000109861 [P53634-1]
ENST00000524463; ENSP00000432541; ENSG00000109861 [P53634-2]
ENST00000529974; ENSP00000433539; ENSG00000109861 [P53634-3]
GeneIDi1075
KEGGihsa:1075
UCSCiuc001pck.5 human [P53634-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Web resourcesi

CTSCbase

CTSC mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X87212 mRNA Translation: CAA60671.1
U79415 Genomic DNA Translation: AAC51341.1
AF234263 mRNA Translation: AAL48191.1
AF234264 mRNA Translation: AAL48192.1
AF254757 mRNA Translation: AAL48195.1
AF525032 mRNA Translation: AAQ08887.1
AF525033 mRNA Translation: AAQ08888.1
AK292117 mRNA Translation: BAF84806.1
AK311923 mRNA Translation: BAG34864.1
AK223038 mRNA Translation: BAD96758.1
BX537913 mRNA Translation: CAD97897.1 Different initiation.
AC011088 Genomic DNA No translation available.
CH471185 Genomic DNA Translation: EAW59364.1
BC054028 mRNA Translation: AAH54028.1
BC100891 mRNA Translation: AAI00892.1
BC100892 mRNA Translation: AAI00893.1
BC100893 mRNA Translation: AAI00894.1
BC100894 mRNA Translation: AAI00895.1
BC109386 mRNA Translation: AAI09387.1
BC110071 mRNA Translation: AAI10072.1
BC113850 mRNA Translation: AAI13851.1
BC113897 mRNA Translation: AAI13898.1
CCDSiCCDS31654.1 [P53634-2]
CCDS44693.1 [P53634-3]
CCDS8282.1 [P53634-1]
PIRiS23941
S66504
RefSeqiNP_001107645.1, NM_001114173.2 [P53634-3]
NP_001805.3, NM_001814.5
NP_680475.1, NM_148170.4 [P53634-2]
UniGeneiHs.128065

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1K3BX-ray2.15A25-143[»]
B231-394[»]
C395-463[»]
2DJFX-ray2.00A25-143[»]
B231-394[»]
C395-463[»]
2DJGX-ray2.05A25-143[»]
B231-394[»]
C395-463[»]
3PDFX-ray1.85A25-463[»]
4CDCX-ray2.40A/D/G/J25-143[»]
B/E/H/K230-394[»]
C/F/I/L395-463[»]
4CDDX-ray2.35A/D25-144[»]
B/E230-394[»]
C/F395-463[»]
4CDEX-ray2.40A/D25-143[»]
B/E230-394[»]
C/F395-463[»]
4CDFX-ray2.20A/D25-144[»]
B/E229-394[»]
C/F395-463[»]
4OELX-ray1.40A25-394[»]
B395-463[»]
4OEMX-ray1.52A25-394[»]
B395-463[»]
ProteinModelPortaliP53634
SMRiP53634
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107502, 25 interactors
IntActiP53634, 22 interactors
MINTiP53634
STRINGi9606.ENSP00000227266

Chemistry databases

BindingDBiP53634
ChEMBLiCHEMBL2252
GuidetoPHARMACOLOGYi2344

Protein family/group databases

MEROPSiC01.070

PTM databases

GlyConnecti1175
iPTMnetiP53634
PhosphoSitePlusiP53634
SwissPalmiP53634

Polymorphism and mutation databases

BioMutaiCTSC
DMDMi317373330

Proteomic databases

EPDiP53634
MaxQBiP53634
PaxDbiP53634
PeptideAtlasiP53634
PRIDEiP53634
ProteomicsDBi56595
56596 [P53634-2]
56597 [P53634-3]
TopDownProteomicsiP53634-1 [P53634-1]

Protocols and materials databases

DNASUi1075
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000227266; ENSP00000227266; ENSG00000109861 [P53634-1]
ENST00000524463; ENSP00000432541; ENSG00000109861 [P53634-2]
ENST00000529974; ENSP00000433539; ENSG00000109861 [P53634-3]
GeneIDi1075
KEGGihsa:1075
UCSCiuc001pck.5 human [P53634-1]

Organism-specific databases

CTDi1075
DisGeNETi1075
EuPathDBiHostDB:ENSG00000109861.15
GeneCardsiCTSC
HGNCiHGNC:2528 CTSC
HPAiCAB025364
HPA066610
HPA068434
MalaCardsiCTSC
MIMi170650 phenotype
245000 phenotype
245010 phenotype
602365 gene
neXtProtiNX_P53634
OpenTargetsiENSG00000109861
Orphaneti2342 Haim-Munk syndrome
678 Papillon-Lefevre syndrome
PharmGKBiPA27028
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1543 Eukaryota
COG4870 LUCA
GeneTreeiENSGT00900000140859
HOGENOMiHOG000127503
HOVERGENiHBG066812
InParanoidiP53634
KOiK01275
OMAiFVTPVRN
OrthoDBiEOG091G06TT
PhylomeDBiP53634
TreeFamiTF313225

Enzyme and pathway databases

BioCyciMetaCyc:HS03265-MONOMER
BRENDAi3.4.14.1 2681
ReactomeiR-HSA-204005 COPII-mediated vesicle transport
R-HSA-2132295 MHC class II antigen presentation
R-HSA-5694530 Cargo concentration in the ER
R-HSA-6798695 Neutrophil degranulation
SABIO-RKiP53634

Miscellaneous databases

ChiTaRSiCTSC human
EvolutionaryTraceiP53634
GeneWikiiCathepsin_C
GenomeRNAii1075
PMAP-CutDBiP53634
PROiPR:P53634
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000109861 Expressed in 221 organ(s), highest expression level in palpebral conjunctiva
ExpressionAtlasiP53634 baseline and differential
GenevisibleiP53634 HS

Family and domain databases

CDDicd02621 Peptidase_C1A_CathepsinC, 1 hit
Gene3Di2.40.128.80, 1 hit
InterProiView protein in InterPro
IPR039412 CatC
IPR014882 CathepsinC_exc
IPR036496 CathepsinC_exc_dom_sf
IPR038765 Papain_like_cys_pep_sf
IPR025661 Pept_asp_AS
IPR000169 Pept_cys_AS
IPR025660 Pept_his_AS
IPR013128 Peptidase_C1A
IPR000668 Peptidase_C1A_C
PANTHERiPTHR12411 PTHR12411, 1 hit
PfamiView protein in Pfam
PF08773 CathepsinC_exc, 1 hit
PF00112 Peptidase_C1, 1 hit
PRINTSiPR00705 PAPAIN
SMARTiView protein in SMART
SM00645 Pept_C1, 1 hit
SUPFAMiSSF54001 SSF54001, 1 hit
SSF75001 SSF75001, 1 hit
PROSITEiView protein in PROSITE
PS00640 THIOL_PROTEASE_ASN, 1 hit
PS00139 THIOL_PROTEASE_CYS, 1 hit
PS00639 THIOL_PROTEASE_HIS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCATC_HUMAN
AccessioniPrimary (citable) accession number: P53634
Secondary accession number(s): A8K7V2
, B5MDD5, Q2HIY8, Q53G93, Q71E75, Q71E76, Q7M4N9, Q7Z3G7, Q7Z5U7, Q8WY99, Q8WYA7, Q8WYA8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 11, 2011
Last modified: November 7, 2018
This is version 194 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Peptidase families
    Classification of peptidase families and list of entries
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again