Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - P53634 (CATC_HUMAN)

Entry version 212 (29 Sep 2021)
Sequence version 2 (11 Jan 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Dipeptidyl peptidase 1

Gene

CTSC

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Thiol protease. Has dipeptidylpeptidase activity. Active against a broad range of dipeptide substrates composed of both polar and hydrophobic amino acids. Proline cannot occupy the P1 position and arginine cannot occupy the P2 position of the substrate. Can act as both an exopeptidase and endopeptidase. Activates serine proteases such as elastase, cathepsin G and granzymes A and B. Can also activate neuraminidase and factor XIII.

1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • Release of an N-terminal dipeptide, Xaa-Yaa-|-Zaa-, except when Xaa is Arg or Lys, or Yaa or Zaa is Pro. EC:3.4.14.1

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

chlorideNote: Binds 1 Cl- ion per heavy chain.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Strongly inhibited by the cysteine peptidase inhibitors mersalyl acid, iodoacetic acid and cystatin. Inhibited by N-ethylmaleimide, Gly-Phe-diazomethane, TLCK, TPCK and, at low pH, by dithiodipyridine. Not inhibited by the serine peptidase inhibitor PMSF, the aminopeptidase inhibitor bestatin, or metal ion chelators.1 Publication

<p>This subsection of the 'Function' section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>pH dependencei

High activity at pH 4.5-6.8.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei2581
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei302Chloride1
Binding sitei304Chloride; via amide nitrogen1
Binding sitei347Chloride1
Active sitei4051
Active sitei4271

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionHydrolase, Protease, Thiol protease
LigandChloride

Enzyme and pathway databases

BioCyc Collection of Pathway/Genome Databases

More...BioCyci		MetaCyc:HS03265-MONOMER

BRENDA Comprehensive Enzyme Information System

More...BRENDAi		3.4.14.1, 2681

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		P53634

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-204005, COPII-mediated vesicle transport
R-HSA-2132295, MHC class II antigen presentation
R-HSA-5694530, Cargo concentration in the ER
R-HSA-6798695, Neutrophil degranulation

SABIO-RK: Biochemical Reaction Kinetics Database

More...SABIO-RKi		P53634

Protein family/group databases

MEROPS protease database

More...MEROPSi		C01.070

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dipeptidyl peptidase 1 (EC:3.4.14.1)
Alternative name(s):
Cathepsin C
Cathepsin J
Dipeptidyl peptidase I
Short name:
DPP-I
Short name:
DPPI
Dipeptidyl transferase
Cleaved into the following 3 chains:
Dipeptidyl peptidase 1 exclusion domain chain
Alternative name(s):
Dipeptidyl peptidase I exclusion domain chain
Dipeptidyl peptidase 1 heavy chain
Alternative name(s):
Dipeptidyl peptidase I heavy chain
Dipeptidyl peptidase 1 light chain
Alternative name(s):
Dipeptidyl peptidase I light chain
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CTSC
Synonyms:CPPI
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:2528, CTSC

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		602365, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P53634

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000109861

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Lysosome

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Papillon-Lefevre syndrome (PLS)13 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disorder characterized by palmoplantar keratosis and severe periodontitis affecting deciduous and permanent dentitions and resulting in premature tooth loss. The palmoplantar keratotic phenotype vary from mild psoriasiform scaly skin to overt hyperkeratosis. Keratosis also affects other sites such as elbows and knees.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_01693339W → S in PLS. 1 PublicationCorresponds to variant dbSNP:rs104894210Ensembl.1
Natural variantiVAR_01903567 – 74Missing in PLS. 1 Publication8
Natural variantiVAR_016934127H → P in PLS. 1 PublicationCorresponds to variant dbSNP:rs104894216Ensembl.1
Natural variantiVAR_019036129V → E in PLS. 1 PublicationCorresponds to variant dbSNP:rs760130711Ensembl.1
Natural variantiVAR_019037139G → R in PLS. 2 PublicationsCorresponds to variant dbSNP:rs749103588Ensembl.1
Natural variantiVAR_019038236D → Y in PLS. 2 PublicationsCorresponds to variant dbSNP:rs764724707Ensembl.1
Natural variantiVAR_009541249V → F in PLS. 2 Publications1
Natural variantiVAR_009542252Q → L in PLS. 2 PublicationsCorresponds to variant dbSNP:rs104894207EnsemblClinVar.1
Natural variantiVAR_019039272R → H in PLS. 1 PublicationCorresponds to variant dbSNP:rs587777534EnsemblClinVar.1
Natural variantiVAR_009543272R → P in PLS. 5 PublicationsCorresponds to variant dbSNP:rs587777534EnsemblClinVar.1
Natural variantiVAR_016935286Q → R in HMS and PLS. 2 PublicationsCorresponds to variant dbSNP:rs104894208EnsemblClinVar.1
Natural variantiVAR_019040291C → Y in PLS. 1 PublicationCorresponds to variant dbSNP:rs748729285EnsemblClinVar.1
Natural variantiVAR_039686294Y → H in PLS. 1 Publication1
Natural variantiVAR_019041300G → D in PLS. 2 Publications1
Natural variantiVAR_019042300G → S in PLS. 1 Publication1
Natural variantiVAR_009544301G → S in PLS. 4 PublicationsCorresponds to variant dbSNP:rs104894214Ensembl.1
Natural variantiVAR_019043301G → V in PLS. 1 Publication1
Natural variantiVAR_019044304Y → N in PLS. 1 Publication1
Natural variantiVAR_019045312Q → R in PLS. 1 PublicationCorresponds to variant dbSNP:rs1484758757Ensembl.1
Natural variantiVAR_019046319E → G in PLS. 1 PublicationCorresponds to variant dbSNP:rs1294233227Ensembl.1
Natural variantiVAR_009545339R → C in PLS. 5 PublicationsCorresponds to variant dbSNP:rs1044703733Ensembl.1
Natural variantiVAR_016944340Y → C in PLS. 2 Publications1
Natural variantiVAR_009546347Y → C in PLS and AP1. 3 PublicationsCorresponds to variant dbSNP:rs104894211EnsemblClinVar.1
Natural variantiVAR_027249405H → N in PLS. 1 Publication1
Natural variantiVAR_027250405H → R in PLS. 1 PublicationCorresponds to variant dbSNP:rs151269219Ensembl.1
Natural variantiVAR_016936429W → C in PLS. 1 PublicationCorresponds to variant dbSNP:rs104894215Ensembl.1
Natural variantiVAR_019048447E → G in PLS. 2 Publications1
Haim-Munk syndrome (HMS)1 Publication
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionAn autosomal recessive disorder characterized by palmoplantar keratosis, onychogryphosis and periodontitis. Additional features are pes planus, arachnodactyly, and acroosteolysis.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_016935286Q → R in HMS and PLS. 2 PublicationsCorresponds to variant dbSNP:rs104894208EnsemblClinVar.1
Periodontititis, aggressive, 1 (AP1)2 Publications
The disease is caused by variants affecting the gene represented in this entry.
Disease descriptionA disease characterized by severe and protracted gingival infections, generalized or localized, leading to tooth loss. Amounts of microbial deposits are generally inconsistent with the severity of periodontal tissue destruction and the progression of attachment and bone loss may be self arresting.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_009546347Y → C in PLS and AP1. 3 PublicationsCorresponds to variant dbSNP:rs104894211EnsemblClinVar.1
Natural variantiVAR_019047412Y → C in AP1. 1 PublicationCorresponds to variant dbSNP:rs28937571EnsemblClinVar.1

Keywords - Diseasei

Disease variant, Palmoplantar keratoderma

Organism-specific databases

DisGeNET

More...DisGeNETi		1075

MalaCards human disease database

More...MalaCardsi		CTSC
MIMi170650, phenotype
245000, phenotype
245010, phenotype

Open Targets

More...OpenTargetsi		ENSG00000109861

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		2342, Haim-Munk syndrome
678, Papillon-Lefevre syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA27028

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		P53634, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2252

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		2344

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CTSC

Domain mapping of disease mutations (DMDM)

More...DMDMi		317373330

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 243 PublicationsAdd BLAST24
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000002633825 – 134Dipeptidyl peptidase 1 exclusion domain chainAdd BLAST110
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes a propeptide, which is a part of a protein that is cleaved during maturation or activation. Once cleaved, a propeptide generally has no independent biological function.<p><a href='/help/propep' target='_top'>More...</a></p>PropeptideiPRO_0000026339135 – 2303 PublicationsAdd BLAST96
ChainiPRO_0000026340231 – 394Dipeptidyl peptidase 1 heavy chainAdd BLAST164
ChainiPRO_0000026341395 – 463Dipeptidyl peptidase 1 light chainAdd BLAST69

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi29N-linked (GlcNAc...) asparagine2 Publications1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi30 ↔ 118
Glycosylationi53N-linked (GlcNAc...) asparagine2 Publications1
Disulfide bondi54 ↔ 136
Glycosylationi119N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi255 ↔ 298
Glycosylationi276N-linked (GlcNAc...) asparagine1 Publication1
Disulfide bondi291 ↔ 331
Disulfide bondi321 ↔ 337

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated. While glycosylation at Asn-53, Asn-119 and Asn-276 is mediated by STT3A-containing complexes, glycosylation at Asn-29 is mediated STT3B-containing complexes.5 Publications
In approximately 50% of the complexes the exclusion domain is cleaved at position 58 or 61. The two parts of the exclusion domain are held together by a disulfide bond.

Keywords - PTMi

Disulfide bond, Glycoprotein, Zymogen

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P53634

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P53634

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		P53634

MaxQB - The MaxQuant DataBase

More...MaxQBi		P53634

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P53634

PeptideAtlas

More...PeptideAtlasi		P53634

PRoteomics IDEntifications database

More...PRIDEi		P53634

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		56595 [P53634-1]
56596 [P53634-2]
56597 [P53634-3]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		P53634-1 [P53634-1]

PTM databases

GlyConnect protein glycosylation platform

More...GlyConnecti		1175, 60 N-Linked glycans (4 sites)

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		P53634, 6 sites, 57 N-linked glycans (4 sites), 1 O-linked glycan (1 site)

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P53634

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P53634

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P53634

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. Highly expressed in lung, kidney and placenta. Detected at intermediate levels in colon, small intestine, spleen and pancreas.1 Publication

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in lymphocytes by IL2/interleukin-2.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000109861, Expressed in palpebral conjunctiva and 234 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P53634, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P53634, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000109861, Tissue enhanced (lymphoid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Tetramer of heterotrimers consisting of exclusion domain, heavy- and light chains.

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		107502, 29 interactors

Protein interaction database and analysis system

More...IntActi		P53634, 26 interactors

Molecular INTeraction database

More...MINTi		P53634

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000227266

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		P53634

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		P53634, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1463
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P53634

Database of comparative protein structure models

More...ModBasei		Search...

Protein Data Bank in Europe - Knowledge Base

More...PDBe-KBi		Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...EvolutionaryTracei		P53634

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the peptidase C1 family.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1543, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155787

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_048219_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P53634

Identification of Orthologs from Complete Genome Data

More...OMAi		CFPYTAK

Database of Orthologous Groups

More...OrthoDBi		1275401at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P53634

TreeFam database of animal gene trees

More...TreeFami		TF313225

Family and domain databases

Conserved Domains Database

More...CDDi		cd02621, Peptidase_C1A_CathepsinC, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.40.128.80, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR039412, CatC
IPR014882, CathepsinC_exc
IPR036496, CathepsinC_exc_dom_sf
IPR038765, Papain-like_cys_pep_sf
IPR025661, Pept_asp_AS
IPR000169, Pept_cys_AS
IPR025660, Pept_his_AS
IPR000668, Peptidase_C1A_C

Pfam protein domain database

More...Pfami		View protein in Pfam
PF08773, CathepsinC_exc, 1 hit
PF00112, Peptidase_C1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00705, PAPAIN

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00645, Pept_C1, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF54001, SSF54001, 1 hit
SSF75001, SSF75001, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00640, THIOL_PROTEASE_ASN, 1 hit
PS00139, THIOL_PROTEASE_CYS, 1 hit
PS00639, THIOL_PROTEASE_HIS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 17 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P53634-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGAGPSLLLA ALLLLLSGDG AVRCDTPANC TYLDLLGTWV FQVGSSGSQR 
        60         70         80         90        100
DVNCSVMGPQ EKKVVVYLQK LDTAYDDLGN SGHFTIIYNQ GFEIVLNDYK 
       110        120        130        140        150
WFAFFKYKEE GSKVTTYCNE TMTGWVHDVL GRNWACFTGK KVGTASENVY 
       160        170        180        190        200
VNIAHLKNSQ EKYSNRLYKY DHNFVKAINA IQKSWTATTY MEYETLTLGD 
       210        220        230        240        250
MIRRSGGHSR KIPRPKPAPL TAEIQQKILH LPTSWDWRNV HGINFVSPVR 
       260        270        280        290        300
NQASCGSCYS FASMGMLEAR IRILTNNSQT PILSPQEVVS CSQYAQGCEG 
       310        320        330        340        350
GFPYLIAGKY AQDFGLVEEA CFPYTGTDSP CKMKEDCFRY YSSEYHYVGG 
       360        370        380        390        400
FYGGCNEALM KLELVHHGPM AVAFEVYDDF LHYKKGIYHH TGLRDPFNPF 
       410        420        430        440        450
ELTNHAVLLV GYGTDSASGM DYWIVKNSWG TGWGENGYFR IRRGTDECAI 
       460 
ESIAVAATPI PKL
Length:463
Mass (Da):51,854
Last modified:January 11, 2011 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i4C9C7C24D900CEE6
GO
Isoform 2 (identifier: P53634-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     107-137: YKEEGSKVTTYCNETMTGWVHDVLGRNWACF → DVTDFISHLFMQLGTVGIYDLPHLRNKLVIK
     138-463: Missing.

Show »
Length:137
Mass (Da):15,169
Checksum:iC68FC076FCB30601
GO
Isoform 3 (identifier: P53634-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     107-141: YKEEGSKVTTYCNETMTGWVHDVLGRNWACFTGKK → DVTDFISHLFMQLGTVGIYDLPHLRNKLAMNRRWG
     142-463: Missing.

Show »
Length:141
Mass (Da):15,700
Checksum:iFAD4B1B511F91F66
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 17 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YCY8H0YCY8_HUMAN
Cathepsin C
CTSC
325Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V2Q8A0A7I2V2Q8_HUMAN
Cathepsin C
CTSC
452Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V466A0A7I2V466_HUMAN
Cathepsin C
CTSC
450Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V5C5A0A7I2V5C5_HUMAN
Cathepsin C
CTSC
302Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V6E3A0A7I2V6E3_HUMAN
Cathepsin C
CTSC
419Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2YQT5A0A7I2YQT5_HUMAN
Dipeptidyl peptidase 1
CTSC
342Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V592A0A7I2V592_HUMAN
Dipeptidyl peptidase 1
CTSC
75Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V2F3A0A7I2V2F3_HUMAN
Dipeptidyl peptidase 1
CTSC
117Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V2V5A0A7I2V2V5_HUMAN
Dipeptidyl peptidase 1
CTSC
143Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V3A2A0A7I2V3A2_HUMAN
Dipeptidyl peptidase 1
CTSC
135Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAD97897 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti63K → I in BAD96758 (Ref. 6) Curated1
Sequence conflicti237W → V AA sequence (PubMed:1586157).Curated1
Sequence conflicti321C → S AA sequence (PubMed:1586157).Curated1
Sequence conflicti355C → M AA sequence (PubMed:1586157).Curated1
Sequence conflicti366H → R AA sequence (PubMed:1586157).Curated1
Sequence conflicti376 – 378VYD → YVY AA sequence (PubMed:1586157).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01693339W → S in PLS. 1 PublicationCorresponds to variant dbSNP:rs104894210Ensembl.1
Natural variantiVAR_01903567 – 74Missing in PLS. 1 Publication8
Natural variantiVAR_016934127H → P in PLS. 1 PublicationCorresponds to variant dbSNP:rs104894216Ensembl.1
Natural variantiVAR_019036129V → E in PLS. 1 PublicationCorresponds to variant dbSNP:rs760130711Ensembl.1
Natural variantiVAR_019037139G → R in PLS. 2 PublicationsCorresponds to variant dbSNP:rs749103588Ensembl.1
Natural variantiVAR_016943153I → T12 PublicationsCorresponds to variant dbSNP:rs217086EnsemblClinVar.1
Natural variantiVAR_019038236D → Y in PLS. 2 PublicationsCorresponds to variant dbSNP:rs764724707Ensembl.1
Natural variantiVAR_009541249V → F in PLS. 2 Publications1
Natural variantiVAR_009542252Q → L in PLS. 2 PublicationsCorresponds to variant dbSNP:rs104894207EnsemblClinVar.1
Natural variantiVAR_019039272R → H in PLS. 1 PublicationCorresponds to variant dbSNP:rs587777534EnsemblClinVar.1
Natural variantiVAR_009543272R → P in PLS. 5 PublicationsCorresponds to variant dbSNP:rs587777534EnsemblClinVar.1
Natural variantiVAR_016935286Q → R in HMS and PLS. 2 PublicationsCorresponds to variant dbSNP:rs104894208EnsemblClinVar.1
Natural variantiVAR_019040291C → Y in PLS. 1 PublicationCorresponds to variant dbSNP:rs748729285EnsemblClinVar.1
Natural variantiVAR_039686294Y → H in PLS. 1 Publication1
Natural variantiVAR_019041300G → D in PLS. 2 Publications1
Natural variantiVAR_019042300G → S in PLS. 1 Publication1
Natural variantiVAR_009544301G → S in PLS. 4 PublicationsCorresponds to variant dbSNP:rs104894214Ensembl.1
Natural variantiVAR_019043301G → V in PLS. 1 Publication1
Natural variantiVAR_019044304Y → N in PLS. 1 Publication1
Natural variantiVAR_019045312Q → R in PLS. 1 PublicationCorresponds to variant dbSNP:rs1484758757Ensembl.1
Natural variantiVAR_019046319E → G in PLS. 1 PublicationCorresponds to variant dbSNP:rs1294233227Ensembl.1
Natural variantiVAR_009545339R → C in PLS. 5 PublicationsCorresponds to variant dbSNP:rs1044703733Ensembl.1
Natural variantiVAR_016944340Y → C in PLS. 2 Publications1
Natural variantiVAR_009546347Y → C in PLS and AP1. 3 PublicationsCorresponds to variant dbSNP:rs104894211EnsemblClinVar.1
Natural variantiVAR_016945401E → K1 PublicationCorresponds to variant dbSNP:rs200627023Ensembl.1
Natural variantiVAR_027249405H → N in PLS. 1 Publication1
Natural variantiVAR_027250405H → R in PLS. 1 PublicationCorresponds to variant dbSNP:rs151269219Ensembl.1
Natural variantiVAR_019047412Y → C in AP1. 1 PublicationCorresponds to variant dbSNP:rs28937571EnsemblClinVar.1
Natural variantiVAR_016936429W → C in PLS. 1 PublicationCorresponds to variant dbSNP:rs104894215Ensembl.1
Natural variantiVAR_019048447E → G in PLS. 2 Publications1
Natural variantiVAR_016946453I → V1 PublicationCorresponds to variant dbSNP:rs3888798EnsemblClinVar.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_043232107 – 141YKEEG…FTGKK → DVTDFISHLFMQLGTVGIYD LPHLRNKLAMNRRWG in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_039123107 – 137YKEEG…NWACF → DVTDFISHLFMQLGTVGIYD LPHLRNKLVIK in isoform 2. 3 PublicationsAdd BLAST31
Alternative sequenceiVSP_039124138 – 463Missing in isoform 2. 3 PublicationsAdd BLAST326
Alternative sequenceiVSP_043233142 – 463Missing in isoform 3. 1 PublicationAdd BLAST322

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
X87212 mRNA Translation: CAA60671.1
U79415 Genomic DNA Translation: AAC51341.1
AF234263 mRNA Translation: AAL48191.1
AF234264 mRNA Translation: AAL48192.1
AF254757 mRNA Translation: AAL48195.1
AF525032 mRNA Translation: AAQ08887.1
AF525033 mRNA Translation: AAQ08888.1
AK292117 mRNA Translation: BAF84806.1
AK311923 mRNA Translation: BAG34864.1
AK223038 mRNA Translation: BAD96758.1
BX537913 mRNA Translation: CAD97897.1 Different initiation.
AC011088 Genomic DNA No translation available.
CH471185 Genomic DNA Translation: EAW59364.1
BC054028 mRNA Translation: AAH54028.1
BC100891 mRNA Translation: AAI00892.1
BC100892 mRNA Translation: AAI00893.1
BC100893 mRNA Translation: AAI00894.1
BC100894 mRNA Translation: AAI00895.1
BC109386 mRNA Translation: AAI09387.1
BC110071 mRNA Translation: AAI10072.1
BC113850 mRNA Translation: AAI13851.1
BC113897 mRNA Translation: AAI13898.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS31654.1 [P53634-2]
CCDS44693.1 [P53634-3]
CCDS8282.1 [P53634-1]

Protein sequence database of the Protein Information Resource

More...PIRi		S23941
S66504

NCBI Reference Sequences

More...RefSeqi		NP_001107645.1, NM_001114173.2 [P53634-3]
NP_001805.3, NM_001814.5 [P53634-1]
NP_680475.1, NM_148170.4 [P53634-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000227266; ENSP00000227266; ENSG00000109861 [P53634-1]
ENST00000524463; ENSP00000432541; ENSG00000109861 [P53634-2]
ENST00000529974; ENSP00000433539; ENSG00000109861 [P53634-3]
ENST00000677106; ENSP00000504568; ENSG00000109861 [P53634-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		1075

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:1075

UCSC genome browser

More...UCSCi		uc001pck.5, human [P53634-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

CTSCbase

CTSC mutation db

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X87212 mRNA Translation: CAA60671.1
U79415 Genomic DNA Translation: AAC51341.1
AF234263 mRNA Translation: AAL48191.1
AF234264 mRNA Translation: AAL48192.1
AF254757 mRNA Translation: AAL48195.1
AF525032 mRNA Translation: AAQ08887.1
AF525033 mRNA Translation: AAQ08888.1
AK292117 mRNA Translation: BAF84806.1
AK311923 mRNA Translation: BAG34864.1
AK223038 mRNA Translation: BAD96758.1
BX537913 mRNA Translation: CAD97897.1 Different initiation.
AC011088 Genomic DNA No translation available.
CH471185 Genomic DNA Translation: EAW59364.1
BC054028 mRNA Translation: AAH54028.1
BC100891 mRNA Translation: AAI00892.1
BC100892 mRNA Translation: AAI00893.1
BC100893 mRNA Translation: AAI00894.1
BC100894 mRNA Translation: AAI00895.1
BC109386 mRNA Translation: AAI09387.1
BC110071 mRNA Translation: AAI10072.1
BC113850 mRNA Translation: AAI13851.1
BC113897 mRNA Translation: AAI13898.1
CCDSiCCDS31654.1 [P53634-2]
CCDS44693.1 [P53634-3]
CCDS8282.1 [P53634-1]
PIRiS23941
S66504
RefSeqiNP_001107645.1, NM_001114173.2 [P53634-3]
NP_001805.3, NM_001814.5 [P53634-1]
NP_680475.1, NM_148170.4 [P53634-2]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1K3BX-ray2.15A25-143[»]
B231-394[»]
C395-463[»]
2DJFX-ray2.00A25-143[»]
B231-394[»]
C395-463[»]
2DJGX-ray2.05A25-143[»]
B231-394[»]
C395-463[»]
3PDFX-ray1.85A25-463[»]
4CDCX-ray2.40A/D/G/J25-143[»]
B/E/H/K230-394[»]
C/F/I/L395-463[»]
4CDDX-ray2.35A/D25-144[»]
B/E230-394[»]
C/F395-463[»]
4CDEX-ray2.40A/D25-143[»]
B/E230-394[»]
C/F395-463[»]
4CDFX-ray2.20A/D25-144[»]
B/E229-394[»]
C/F395-463[»]
4OELX-ray1.40A25-394[»]
B395-463[»]
4OEMX-ray1.52A25-394[»]
B395-463[»]
SMRiP53634
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi107502, 29 interactors
IntActiP53634, 26 interactors
MINTiP53634
STRINGi9606.ENSP00000227266

Chemistry databases

BindingDBiP53634
ChEMBLiCHEMBL2252
GuidetoPHARMACOLOGYi2344

Protein family/group databases

MEROPSiC01.070

PTM databases

GlyConnecti1175, 60 N-Linked glycans (4 sites)
GlyGeniP53634, 6 sites, 57 N-linked glycans (4 sites), 1 O-linked glycan (1 site)
iPTMnetiP53634
PhosphoSitePlusiP53634
SwissPalmiP53634

Genetic variation databases

BioMutaiCTSC
DMDMi317373330

Proteomic databases

EPDiP53634
jPOSTiP53634
MassIVEiP53634
MaxQBiP53634
PaxDbiP53634
PeptideAtlasiP53634
PRIDEiP53634
ProteomicsDBi56595 [P53634-1]
56596 [P53634-2]
56597 [P53634-3]
TopDownProteomicsiP53634-1 [P53634-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		31473, 287 antibodies

The DNASU plasmid repository

More...DNASUi		1075

Genome annotation databases

EnsembliENST00000227266; ENSP00000227266; ENSG00000109861 [P53634-1]
ENST00000524463; ENSP00000432541; ENSG00000109861 [P53634-2]
ENST00000529974; ENSP00000433539; ENSG00000109861 [P53634-3]
ENST00000677106; ENSP00000504568; ENSG00000109861 [P53634-2]
GeneIDi1075
KEGGihsa:1075
UCSCiuc001pck.5, human [P53634-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		1075
DisGeNETi1075

GeneCards: human genes, protein and diseases

More...GeneCardsi		CTSC
HGNCiHGNC:2528, CTSC
HPAiENSG00000109861, Tissue enhanced (lymphoid)
MalaCardsiCTSC
MIMi170650, phenotype
245000, phenotype
245010, phenotype
602365, gene
neXtProtiNX_P53634
OpenTargetsiENSG00000109861
Orphaneti2342, Haim-Munk syndrome
678, Papillon-Lefevre syndrome
PharmGKBiPA27028
VEuPathDBiHostDB:ENSG00000109861

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1543, Eukaryota
GeneTreeiENSGT00940000155787
HOGENOMiCLU_048219_0_0_1
InParanoidiP53634
OMAiCFPYTAK
OrthoDBi1275401at2759
PhylomeDBiP53634
TreeFamiTF313225

Enzyme and pathway databases

BioCyciMetaCyc:HS03265-MONOMER
BRENDAi3.4.14.1, 2681
PathwayCommonsiP53634
ReactomeiR-HSA-204005, COPII-mediated vesicle transport
R-HSA-2132295, MHC class II antigen presentation
R-HSA-5694530, Cargo concentration in the ER
R-HSA-6798695, Neutrophil degranulation
SABIO-RKiP53634

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		1075, 6 hits in 1018 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CTSC, human
EvolutionaryTraceiP53634

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Cathepsin_C

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		1075
PharosiP53634, Tchem

Protein Ontology

More...PROi		PR:P53634
RNActiP53634, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000109861, Expressed in palpebral conjunctiva and 234 other tissues
ExpressionAtlasiP53634, baseline and differential
GenevisibleiP53634, HS

Family and domain databases

CDDicd02621, Peptidase_C1A_CathepsinC, 1 hit
Gene3Di2.40.128.80, 1 hit
InterProiView protein in InterPro
IPR039412, CatC
IPR014882, CathepsinC_exc
IPR036496, CathepsinC_exc_dom_sf
IPR038765, Papain-like_cys_pep_sf
IPR025661, Pept_asp_AS
IPR000169, Pept_cys_AS
IPR025660, Pept_his_AS
IPR000668, Peptidase_C1A_C
PfamiView protein in Pfam
PF08773, CathepsinC_exc, 1 hit
PF00112, Peptidase_C1, 1 hit
PRINTSiPR00705, PAPAIN
SMARTiView protein in SMART
SM00645, Pept_C1, 1 hit
SUPFAMiSSF54001, SSF54001, 1 hit
SSF75001, SSF75001, 1 hit
PROSITEiView protein in PROSITE
PS00640, THIOL_PROTEASE_ASN, 1 hit
PS00139, THIOL_PROTEASE_CYS, 1 hit
PS00639, THIOL_PROTEASE_HIS, 1 hit

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCATC_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P53634
Secondary accession number(s): A8K7V2
, B5MDD5, Q2HIY8, Q53G93, Q71E75, Q71E76, Q7M4N9, Q7Z3G7, Q7Z5U7, Q8WY99, Q8WYA7, Q8WYA8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 11, 2011
Last modified: September 29, 2021
This is version 212 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Direct protein sequencing, Reference proteome

Documents

  1. Peptidase families
    Classification of peptidase families and list of entries
  2. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  3. Human entries with genetic variants
    List of human entries with genetic variants
  4. Human variants curated from literature reports
    Index of human variants curated from literature reports
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again