Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1

Gene

NDST1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis (PubMed:10758005, PubMed:12634318). Plays a role in determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence is absolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands, thereby playing a role in inflammatory response (PubMed:10758005, PubMed:12634318). Required for the exosomal release of SDCBP, CD63 and syndecan (PubMed:22660413).3 Publications

Miscellaneous

The presence of 4 different heparan sulfate N-deacetylase/N-sulfotransferase enzymes in mammals, as well as differences in their enzyme activity suggest that some initiate heparan sulfate modification/sulfation reactions, whereas other later on fill in or extend already modified heparan sulfate sequences.

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section describes biophysical and chemical properties, such as maximal absorption, kinetic parameters, pH dependence, redox potentials and temperature dependence.<p><a href='/help/biophysicochemical_properties' target='_top'>More...</a></p>Kineticsi

  1. KM=13.3 µM for K5 polysaccharide1 Publication
  2. KM=0.35 µM for N-acetylated HS-II1 Publication

    <p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: heparan sulfate biosynthesis

    This protein is involved in the pathway heparan sulfate biosynthesis, which is part of Glycan metabolism.
    View all proteins of this organism that are known to be involved in the pathway heparan sulfate biosynthesis and in Glycan metabolism.

    Pathwayi: heparin biosynthesis

    This protein is involved in the pathway heparin biosynthesis, which is part of Glycan metabolism.
    View all proteins of this organism that are known to be involved in the pathway heparin biosynthesis and in Glycan metabolism.

    Sites

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei614For sulfotransferase activity1
    <p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei712PAPS1 Publication1

    Regions

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi614 – 618PAPS1 Publication5
    Nucleotide bindingi833 – 837PAPS1 Publication5

    <p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

    GO - Biological processi

    <p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

    Molecular functionHydrolase, Multifunctional enzyme, Transferase
    Biological processInflammatory response

    Enzyme and pathway databases

    BioCyc Collection of Pathway/Genome Databases

    More...
    BioCyci
    MetaCyc:HS01001-MONOMER

    Reactome - a knowledgebase of biological pathways and processes

    More...
    Reactomei
    R-HSA-2022928 HS-GAG biosynthesis

    SABIO-RK: Biochemical Reaction Kinetics Database

    More...
    SABIO-RKi
    P52848

    UniPathway: a resource for the exploration and annotation of metabolic pathways

    More...
    UniPathwayi
    UPA00756

    UPA00862

    <p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
    Recommended name:
    Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 (EC:2.8.2.8)
    Alternative name(s):
    Glucosaminyl N-deacetylase/N-sulfotransferase 1
    Short name:
    NDST-1
    N-heparan sulfate sulfotransferase 1
    Short name:
    N-HSST 1
    [Heparan sulfate]-glucosamine N-sulfotransferase 1
    Short name:
    HSNST 1
    Including the following 2 domains:
    Heparan sulfate N-deacetylase 1 (EC:3.-.-.-)
    Heparan sulfate N-sulfotransferase 1 (EC:2.8.2.-)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
    Name:NDST1
    Synonyms:HSST, HSST1
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
    • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

    Organism-specific databases

    Eukaryotic Pathogen Database Resources

    More...
    EuPathDBi
    HostDB:ENSG00000070614.14

    Human Gene Nomenclature Database

    More...
    HGNCi
    HGNC:7680 NDST1

    Online Mendelian Inheritance in Man (OMIM)

    More...
    MIMi
    600853 gene

    neXtProt; the human protein knowledge platform

    More...
    neXtProti
    NX_P52848

    <p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

    Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

    Topology

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 17CytoplasmicSequence analysisAdd BLAST17
    <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei18 – 39Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST22
    Topological domaini40 – 882LumenalSequence analysisAdd BLAST843

    Keywords - Cellular componenti

    Golgi apparatus, Membrane

    <p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

    <p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

    Mental retardation, autosomal recessive 46 (MRT46)1 Publication
    The disease is caused by mutations affecting the gene represented in this entry.
    Disease descriptionA disorder characterized by significantly below average general intellectual functioning associated with impairments in adaptive behavior and manifested during the developmental period. MRT46 manifestations include delayed psychomotor development apparent from infancy or early childhood, delayed or absent expressive speech, hypotonia, and therapy-responsive seizures in some patients. Behavioral abnormalities are variable and include aggression, self-injurious behavior, and sleep disturbances.
    See also OMIM:616116
    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_072646611G → S in MRT46. 1 PublicationCorresponds to variant dbSNP:rs606231459EnsemblClinVar.1
    Natural variantiVAR_072647640F → L in MRT46. 1 PublicationCorresponds to variant dbSNP:rs606231458EnsemblClinVar.1
    Natural variantiVAR_072648642E → D in MRT46. 1 PublicationCorresponds to variant dbSNP:rs606231457EnsemblClinVar.1
    Natural variantiVAR_072649709R → Q in MRT46. 1 PublicationCorresponds to variant dbSNP:rs606231456EnsemblClinVar.1

    Mutagenesis

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi614K → A: Loss of sulfotransferase activity. 1 Publication1

    Keywords - Diseasei

    Disease mutation, Mental retardation

    Organism-specific databases

    DisGeNET

    More...
    DisGeNETi
    3340

    MalaCards human disease database

    More...
    MalaCardsi
    NDST1
    MIMi616116 phenotype

    Open Targets

    More...
    OpenTargetsi
    ENSG00000070614

    Orphanet; a database dedicated to information on rare diseases and orphan drugs

    More...
    Orphaneti
    88616 Autosomal recessive non-syndromic intellectual disability

    The Pharmacogenetics and Pharmacogenomics Knowledge Base

    More...
    PharmGKBi
    PA31486

    Chemistry databases

    Drug and drug target database

    More...
    DrugBanki
    DB01812 Adenosine-3'-5'-Diphosphate

    Polymorphism and mutation databases

    BioMuta curated single-nucleotide variation and disease association database

    More...
    BioMutai
    NDST1

    <p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

    Molecule processing

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000852101 – 882Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1Add BLAST882

    Amino acid modifications

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi231N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi351N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi401N-linked (GlcNAc...) asparagineSequence analysis1
    Glycosylationi667N-linked (GlcNAc...) asparagineSequence analysis1
    <p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi818 ↔ 8281 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    Encyclopedia of Proteome Dynamics

    More...
    EPDi
    P52848

    jPOST - Japan Proteome Standard Repository/Database

    More...
    jPOSTi
    P52848

    MaxQB - The MaxQuant DataBase

    More...
    MaxQBi
    P52848

    PaxDb, a database of protein abundance averages across all three domains of life

    More...
    PaxDbi
    P52848

    PeptideAtlas

    More...
    PeptideAtlasi
    P52848

    PRoteomics IDEntifications database

    More...
    PRIDEi
    P52848

    ProteomicsDB human proteome resource

    More...
    ProteomicsDBi
    56543
    56544 [P52848-2]

    PTM databases

    iPTMnet integrated resource for PTMs in systems biology context

    More...
    iPTMneti
    P52848

    Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

    More...
    PhosphoSitePlusi
    P52848

    <p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

    <p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

    Widely expressed. Expression is most abundant in heart, liver and pancreas.

    Gene expression databases

    Bgee dataBase for Gene Expression Evolution

    More...
    Bgeei
    ENSG00000070614 Expressed in 237 organ(s), highest expression level in liver

    CleanEx database of gene expression profiles

    More...
    CleanExi
    HS_NDST1

    ExpressionAtlas, Differential and Baseline Expression

    More...
    ExpressionAtlasi
    P52848 baseline and differential

    Genevisible search portal to normalized and curated expression data from Genevestigator

    More...
    Genevisiblei
    P52848 HS

    Organism-specific databases

    Human Protein Atlas

    More...
    HPAi
    HPA060532

    <p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

    <p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

    Monomer (PubMed:10196134). Interacts with EXT2 (PubMed:18337501).2 Publications

    Protein-protein interaction databases

    The Biological General Repository for Interaction Datasets (BioGrid)

    More...
    BioGridi
    109572, 16 interactors

    STRING: functional protein association networks

    More...
    STRINGi
    9606.ENSP00000261797

    <p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

    Secondary structure

    1882
    Legend: HelixTurnBeta strandPDB Structure known for this area
    Show more details

    3D structure databases

    Select the link destinations:

    Protein Data Bank Europe

    More...
    PDBei

    Protein Data Bank RCSB

    More...
    RCSB PDBi

    Protein Data Bank Japan

    More...
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    1NSTX-ray2.30A558-882[»]

    Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

    More...
    ProteinModelPortali
    P52848

    SWISS-MODEL Repository - a database of annotated 3D protein structure models

    More...
    SMRi
    P52848

    Database of comparative protein structure models

    More...
    ModBasei
    Search...

    MobiDB: a database of protein disorder and mobility annotations

    More...
    MobiDBi
    Search...

    Miscellaneous databases

    Relative evolutionary importance of amino acids within a protein sequence

    More...
    EvolutionaryTracei
    P52848

    <p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

    Region

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni40 – 598Heparan sulfate N-deacetylase 1Add BLAST559
    Regioni599 – 882Heparan sulfate N-sulfotransferase 1Add BLAST284

    <p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    evolutionary genealogy of genes: Non-supervised Orthologous Groups

    More...
    eggNOGi
    KOG3703 Eukaryota
    ENOG410XQN4 LUCA

    Ensembl GeneTree

    More...
    GeneTreei
    ENSGT00940000157857

    The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

    More...
    HOGENOMi
    HOG000008010

    The HOVERGEN Database of Homologous Vertebrate Genes

    More...
    HOVERGENi
    HBG082011

    InParanoid: Eukaryotic Ortholog Groups

    More...
    InParanoidi
    P52848

    KEGG Orthology (KO)

    More...
    KOi
    K02576

    Identification of Orthologs from Complete Genome Data

    More...
    OMAi
    QVWNIRV

    Database of Orthologous Groups

    More...
    OrthoDBi
    388292at2759

    Database for complete collections of gene phylogenies

    More...
    PhylomeDBi
    P52848

    TreeFam database of animal gene trees

    More...
    TreeFami
    TF313193

    Family and domain databases

    Integrated resource of protein families, domains and functional sites

    More...
    InterProi
    View protein in InterPro
    IPR021930 Heparan_SO4_deacetylase
    IPR037359 NST/OST
    IPR027417 P-loop_NTPase
    IPR000863 Sulfotransferase_dom

    The PANTHER Classification System

    More...
    PANTHERi
    PTHR10605 PTHR10605, 1 hit

    Pfam protein domain database

    More...
    Pfami
    View protein in Pfam
    PF12062 HSNSD, 1 hit
    PF00685 Sulfotransfer_1, 1 hit

    Superfamily database of structural and functional annotation

    More...
    SUPFAMi
    SSF52540 SSF52540, 1 hit

    <p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

    <p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

    This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

    This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

    Isoform 1 (identifier: P52848-1) [UniParc]FASTAAdd to basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide
            10         20         30         40         50
    MPALACLRRL CRHVSPQAVL FLLFIFCLFS VFISAYYLYG WKRGLEPSAD
    60 70 80 90 100
    APEPDCGDPP PVAPSRLLPL KPVQAATPSR TDPLVLVFVE SLYSQLGQEV
    110 120 130 140 150
    VAILESSRFK YRTEIAPGKG DMPTLTDKGR GRFALIIYEN ILKYVNLDAW
    160 170 180 190 200
    NRELLDKYCV AYGVGIIGFF KANENSLLSA QLKGFPLFLH SNLGLKDCSI
    210 220 230 240 250
    NPKSPLLYVT RPSEVEKGVL PGEDWTVFQS NHSTYEPVLL AKTRSSESIP
    260 270 280 290 300
    HLGADAGLHA ALHATVVQDL GLHDGIQRVL FGNNLNFWLH KLVFVDAVAF
    310 320 330 340 350
    LTGKRLSLPL DRYILVDIDD IFVGKEGTRM KVEDVKALFD TQNELRAHIP
    360 370 380 390 400
    NFTFNLGYSG KFFHTGTNAE DAGDDLLLSY VKEFWWFPHM WSHMQPHLFH
    410 420 430 440 450
    NQSVLAEQMA LNKKFAVEHG IPTDMGYAVA PHHSGVYPVH VQLYEAWKQV
    460 470 480 490 500
    WSIRVTSTEE YPHLKPARYR RGFIHNGIMV LPRQTCGLFT HTIFYNEYPG
    510 520 530 540 550
    GSSELDKIIN GGELFLTVLL NPISIFMTHL SNYGNDRLGL YTFKHLVRFL
    560 570 580 590 600
    HSWTNLRLQT LPPVQLAQKY FQIFSEEKDP LWQDPCEDKR HKDIWSKEKT
    610 620 630 640 650
    CDRFPKLLII GPQKTGTTAL YLFLGMHPDL SSNYPSSETF EEIQFFNGHN
    660 670 680 690 700
    YHKGIDWYME FFPIPSNTTS DFYFEKSANY FDSEVAPRRA AALLPKAKVL
    710 720 730 740 750
    TILINPADRA YSWYQHQRAH DDPVALKYTF HEVITAGSDA SSKLRALQNR
    760 770 780 790 800
    CLVPGWYATH IERWLSAYHA NQILVLDGKL LRTEPAKVMD MVQKFLGVTN
    810 820 830 840 850
    TIDYHKTLAF DPKKGFWCQL LEGGKTKCLG KSKGRKYPEM DLDSRAFLKD
    860 870 880
    YYRDHNIELS KLLYKMGQTL PTWLREDLQN TR
    Length:882
    Mass (Da):100,868
    Last modified:October 1, 1996 - v1
    <p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD4B716B84A0BF4C4
    GO
    Isoform 2 (identifier: P52848-2) [UniParc]FASTAAdd to basket

    The sequence of this isoform differs from the canonical sequence as follows:
         523-556: ISIFMTHLSNYGNDRLGLYTFKHLVRFLHSWTNL → VSAPQPMAAGEKGLLHSLSAADTGFLEPGKGGEA
         557-882: Missing.

    Note: No experimental confirmation available.
    Show »
    Length:556
    Mass (Da):62,065
    Checksum:iC3D09802532B4D97
    GO

    <p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

    There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
    EntryEntry nameProtein names
    Gene namesLengthAnnotation
    E7EVJ3E7EVJ3_HUMAN
    Bifunctional heparan sulfate N-deac...
    NDST1
    825Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    E5RG58E5RG58_HUMAN
    Bifunctional heparan sulfate N-deac...
    NDST1
    159Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    E5RGN9E5RGN9_HUMAN
    Bifunctional heparan sulfate N-deac...
    NDST1
    68Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
    E5RG24E5RG24_HUMAN
    Bifunctional heparan sulfate N-deac...
    NDST1
    23Annotation score:

    Annotation score:1 out of 5

    <p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

    Experimental Info

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti24 – 28FIFCL → QVVCQ in AAH12888 (PubMed:15489334).Curated5
    Sequence conflicti60P → A in AAA67765 (Ref. 3) Curated1
    Sequence conflicti364H → Q in AAH12888 (PubMed:15489334).Curated1
    Sequence conflicti689R → G in AAA67765 (Ref. 3) Curated1
    Sequence conflicti743K → R in AAA67765 (Ref. 3) Curated1

    Natural variant

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    Natural variantiVAR_072646611G → S in MRT46. 1 PublicationCorresponds to variant dbSNP:rs606231459EnsemblClinVar.1
    Natural variantiVAR_072647640F → L in MRT46. 1 PublicationCorresponds to variant dbSNP:rs606231458EnsemblClinVar.1
    Natural variantiVAR_072648642E → D in MRT46. 1 PublicationCorresponds to variant dbSNP:rs606231457EnsemblClinVar.1
    Natural variantiVAR_072649709R → Q in MRT46. 1 PublicationCorresponds to variant dbSNP:rs606231456EnsemblClinVar.1

    Alternative sequence

    Feature keyPosition(s)DescriptionActionsGraphical viewLength
    <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_017397523 – 556ISIFM…SWTNL → VSAPQPMAAGEKGLLHSLSA ADTGFLEPGKGGEA in isoform 2. 1 PublicationAdd BLAST34
    Alternative sequenceiVSP_017398557 – 882Missing in isoform 2. 1 PublicationAdd BLAST326

    Sequence databases

    Select the link destinations:

    EMBL nucleotide sequence database

    More...
    EMBLi

    GenBank nucleotide sequence database

    More...
    GenBanki

    DNA Data Bank of Japan; a nucleotide sequence database

    More...
    DDBJi
    Links Updated
    U18918 mRNA Translation: AAA75281.1
    U36600 mRNA Translation: AAC27354.1
    U17970 mRNA Translation: AAA67765.1
    BC012888 mRNA Translation: AAH12888.1

    The Consensus CDS (CCDS) project

    More...
    CCDSi
    CCDS34277.1 [P52848-1]

    Protein sequence database of the Protein Information Resource

    More...
    PIRi
    A57169

    NCBI Reference Sequences

    More...
    RefSeqi
    NP_001287992.1, NM_001301063.1
    NP_001534.1, NM_001543.4 [P52848-1]
    XP_006714846.1, XM_006714783.1 [P52848-1]
    XP_016864917.1, XM_017009428.1 [P52848-1]
    XP_016864918.1, XM_017009429.1 [P52848-1]
    XP_016864919.1, XM_017009430.1 [P52848-1]
    XP_016864920.1, XM_017009431.1 [P52848-1]

    UniGene gene-oriented nucleotide sequence clusters

    More...
    UniGenei
    Hs.222055

    Genome annotation databases

    Ensembl eukaryotic genome annotation project

    More...
    Ensembli
    ENST00000261797; ENSP00000261797; ENSG00000070614 [P52848-1]

    Database of genes from NCBI RefSeq genomes

    More...
    GeneIDi
    3340

    KEGG: Kyoto Encyclopedia of Genes and Genomes

    More...
    KEGGi
    hsa:3340

    UCSC genome browser

    More...
    UCSCi
    uc003lsk.4 human [P52848-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    <p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

    <p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBLi
    GenBanki
    DDBJi
    Links Updated
    U18918 mRNA Translation: AAA75281.1
    U36600 mRNA Translation: AAC27354.1
    U17970 mRNA Translation: AAA67765.1
    BC012888 mRNA Translation: AAH12888.1
    CCDSiCCDS34277.1 [P52848-1]
    PIRiA57169
    RefSeqiNP_001287992.1, NM_001301063.1
    NP_001534.1, NM_001543.4 [P52848-1]
    XP_006714846.1, XM_006714783.1 [P52848-1]
    XP_016864917.1, XM_017009428.1 [P52848-1]
    XP_016864918.1, XM_017009429.1 [P52848-1]
    XP_016864919.1, XM_017009430.1 [P52848-1]
    XP_016864920.1, XM_017009431.1 [P52848-1]
    UniGeneiHs.222055

    3D structure databases

    Select the link destinations:
    PDBei
    RCSB PDBi
    PDBji
    Links Updated
    PDB entryMethodResolution (Å)ChainPositionsPDBsum
    1NSTX-ray2.30A558-882[»]
    ProteinModelPortaliP52848
    SMRiP52848
    ModBaseiSearch...
    MobiDBiSearch...

    Protein-protein interaction databases

    BioGridi109572, 16 interactors
    STRINGi9606.ENSP00000261797

    Chemistry databases

    DrugBankiDB01812 Adenosine-3'-5'-Diphosphate

    PTM databases

    iPTMnetiP52848
    PhosphoSitePlusiP52848

    Polymorphism and mutation databases

    BioMutaiNDST1

    Proteomic databases

    EPDiP52848
    jPOSTiP52848
    MaxQBiP52848
    PaxDbiP52848
    PeptideAtlasiP52848
    PRIDEiP52848
    ProteomicsDBi56543
    56544 [P52848-2]

    Protocols and materials databases

    Structural Biology KnowledgebaseSearch...

    Genome annotation databases

    EnsembliENST00000261797; ENSP00000261797; ENSG00000070614 [P52848-1]
    GeneIDi3340
    KEGGihsa:3340
    UCSCiuc003lsk.4 human [P52848-1]

    Organism-specific databases

    Comparative Toxicogenomics Database

    More...
    CTDi
    3340
    DisGeNETi3340
    EuPathDBiHostDB:ENSG00000070614.14

    GeneCards: human genes, protein and diseases

    More...
    GeneCardsi
    NDST1
    HGNCiHGNC:7680 NDST1
    HPAiHPA060532
    MalaCardsiNDST1
    MIMi600853 gene
    616116 phenotype
    neXtProtiNX_P52848
    OpenTargetsiENSG00000070614
    Orphaneti88616 Autosomal recessive non-syndromic intellectual disability
    PharmGKBiPA31486

    GenAtlas: human gene database

    More...
    GenAtlasi
    Search...

    Phylogenomic databases

    eggNOGiKOG3703 Eukaryota
    ENOG410XQN4 LUCA
    GeneTreeiENSGT00940000157857
    HOGENOMiHOG000008010
    HOVERGENiHBG082011
    InParanoidiP52848
    KOiK02576
    OMAiQVWNIRV
    OrthoDBi388292at2759
    PhylomeDBiP52848
    TreeFamiTF313193

    Enzyme and pathway databases

    UniPathwayi
    UPA00756

    UPA00862

    BioCyciMetaCyc:HS01001-MONOMER
    ReactomeiR-HSA-2022928 HS-GAG biosynthesis
    SABIO-RKiP52848

    Miscellaneous databases

    ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

    More...
    ChiTaRSi
    NDST1 human
    EvolutionaryTraceiP52848

    The Gene Wiki collection of pages on human genes and proteins

    More...
    GeneWikii
    NDST1

    Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

    More...
    GenomeRNAii
    3340

    Protein Ontology

    More...
    PROi
    PR:P52848

    The Stanford Online Universal Resource for Clones and ESTs

    More...
    SOURCEi
    Search...

    Gene expression databases

    BgeeiENSG00000070614 Expressed in 237 organ(s), highest expression level in liver
    CleanExiHS_NDST1
    ExpressionAtlasiP52848 baseline and differential
    GenevisibleiP52848 HS

    Family and domain databases

    InterProiView protein in InterPro
    IPR021930 Heparan_SO4_deacetylase
    IPR037359 NST/OST
    IPR027417 P-loop_NTPase
    IPR000863 Sulfotransferase_dom
    PANTHERiPTHR10605 PTHR10605, 1 hit
    PfamiView protein in Pfam
    PF12062 HSNSD, 1 hit
    PF00685 Sulfotransfer_1, 1 hit
    SUPFAMiSSF52540 SSF52540, 1 hit

    ProtoNet; Automatic hierarchical classification of proteins

    More...
    ProtoNeti
    Search...

    <p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

    <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNDST1_HUMAN
    <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P52848
    Secondary accession number(s): Q96E57
    <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
    Last sequence update: October 1, 1996
    Last modified: January 16, 2019
    This is version 168 of the entry and version 1 of the sequence. See complete history.
    <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    <p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    6. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    7. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    UniProt is an ELIXIR core data resource
    Main funding by: National Institutes of Health

    We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

    Do not show this banner again