Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Beta-chimaerin

Gene

CHN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

GTPase-activating protein for p21-rac. Insufficient expression of beta-2 chimaerin is expected to lead to higher Rac activity and could therefore play a role in the progression from low-grade to high-grade tumors.

<p>This subsection of the ‘Function’ section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

In the inactive state, the N terminus protrudes into the active site of the Rho-GAP domain, sterically blocking Rac binding. Phospholipid binding to the Phorbol-ester/DAG-type zinc-finger/C1 domain triggers the cooperative dissociation of these interactions, allowing the N-terminus to move out of the active site and thereby activating the enzyme.1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri214 – 264Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST51

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTPase activator activity Source: Reactome
  • metal ion binding Source: UniProtKB-KW
  • SH3/SH2 adaptor activity Source: ProtInc

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-194840 Rho GTPase cycle

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
P52757

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P52757

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Beta-chimaerin
Alternative name(s):
Beta-chimerin
Rho GTPase-activating protein 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CHN2
Synonyms:ARHGAP3, BCH
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000106069.20

Human Gene Nomenclature Database

More...
HGNCi
HGNC:1944 CHN2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602857 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P52757

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
1124

Open Targets

More...
OpenTargetsi
ENSG00000106069

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26474

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL4504

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CHN2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
2506455

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000566971 – 468Beta-chimaerinAdd BLAST468

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P52757

PeptideAtlas

More...
PeptideAtlasi
P52757

PRoteomics IDEntifications database

More...
PRIDEi
P52757

ProteomicsDB human proteome resource

More...
ProteomicsDBi
56529

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P52757

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P52757

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest levels in the brain and pancreas. Also expressed in the heart, placenta, and weakly in the kidney and liver. Expression is much reduced in the malignant gliomas, compared to normal brain or low-grade astrocytomas.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000106069 Expressed in 204 organ(s), highest expression level in cerebellar vermis

CleanEx database of gene expression profiles

More...
CleanExi
HS_CHN2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P52757 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P52757 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA018989

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107548, 9 interactors

Protein interaction database and analysis system

More...
IntActi
P52757, 14 interactors

Molecular INTeraction database

More...
MINTi
P52757

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000222792

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
P52757

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1468
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P52757

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P52757

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P52757

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini59 – 127SH2PROSITE-ProRule annotationAdd BLAST69
Domaini277 – 468Rho-GAPPROSITE-ProRule annotationAdd BLAST192

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri214 – 264Phorbol-ester/DAG-typePROSITE-ProRule annotationAdd BLAST51

Keywords - Domaini

SH2 domain, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1453 Eukaryota
ENOG410YM3I LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153726

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231926

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG080489

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P52757

KEGG Orthology (KO)

More...
KOi
K20630

Identification of Orthologs from Complete Genome Data

More...
OMAi
IICPGEV

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0834

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P52757

TreeFam database of animal gene trees

More...
TreeFami
TF342052

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00029 C1, 1 hit
cd04372 RhoGAP_chimaerin, 1 hit
cd10352 SH2_a2chimerin_b2chimerin, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.555.10, 1 hit
3.30.505.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035840 Chimaerin_SH2
IPR017356 CHN1/CHN2
IPR020454 DAG/PE-bd
IPR002219 PE/DAG-bd
IPR008936 Rho_GTPase_activation_prot
IPR037860 RhoGAP_chimaerin
IPR000198 RhoGAP_dom
IPR000980 SH2
IPR036860 SH2_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00130 C1_1, 1 hit
PF00620 RhoGAP, 1 hit
PF00017 SH2, 1 hit

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF038015 N-chimaerin, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00008 DAGPEDOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00109 C1, 1 hit
SM00324 RhoGAP, 1 hit
SM00252 SH2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48350 SSF48350, 1 hit
SSF55550 SSF55550, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50238 RHOGAP, 1 hit
PS50001 SH2, 1 hit
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 9 potential isoforms that are computationally mapped.Show allAlign All

Isoform Beta-2 (identifier: P52757-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAASSNSSLS GSSVSSDAEE YQPPIWKSYL YQLQQEAPRP KRIICPREVE
60 70 80 90 100
NRPKYYGREF HGIISREQAD ELLGGVEGAY ILRESQRQPG CYTLALRFGN
110 120 130 140 150
QTLNYRLFHD GKHFVGEKRF ESIHDLVTDG LITLYIETKA AEYISKMTTN
160 170 180 190 200
PIYEHIGYAT LLREKVSRRL SRSKNEPRKT NVTHEEHTAV EKISSLVRRA
210 220 230 240 250
ALTHNDNHFN YEKTHNFKVH TFRGPHWCEY CANFMWGLIA QGVRCSDCGL
260 270 280 290 300
NVHKQCSKHV PNDCQPDLKR IKKVYCCDLT TLVKAHNTQR PMVVDICIRE
310 320 330 340 350
IEARGLKSEG LYRVSGFTEH IEDVKMAFDR DGEKADISAN VYPDINIITG
360 370 380 390 400
ALKLYFRDLP IPVITYDTYS KFIDAAKISN ADERLEAVHE VLMLLPPAHY
410 420 430 440 450
ETLRYLMIHL KKVTMNEKDN FMNAENLGIV FGPTLMRPPE DSTLTTLHDM
460
RYQKLIVQIL IENEDVLF
Length:468
Mass (Da):53,924
Last modified:November 1, 1997 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i63254958E0B5804C
GO
Isoform Beta-1 (identifier: P52757-2)
Sequence is not available
Length:
Mass (Da):
Isoform 3 (identifier: P52757-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MAASSNSSLS...REVENRPKYY → MFSEELWLEN...PPLKLFACSQ
     57-192: Missing.

Note: No experimental confirmation available.
Show »
Length:332
Mass (Da):38,178
Checksum:i7A2B5C42F1769425
GO
Isoform 4 (identifier: P52757-4) [UniParc]FASTAAdd to basket
Also known as: B1-CHNdel ex7p

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQE → MFSEELWLENEKKCAVVRKSKQGRKRQELLAVAFGV
     37-217: Missing.

Show »
Length:287
Mass (Da):33,053
Checksum:i919FF9A301706C6E
GO
Isoform 5 (identifier: P52757-5) [UniParc]FASTAAdd to basket
Also known as: B1-CHNdel ex9

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MAASSNSSLS...REVENRPKYY → MFSEELWLEN...PPLKLFACSQ
     57-192: Missing.
     247-304: Missing.

Show »
Length:274
Mass (Da):31,518
Checksum:i4216F583B958B41F
GO
Isoform 6 (identifier: P52757-6) [UniParc]FASTAAdd to basket
Also known as: B1-CHNdel ex7p,11

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQE → MFSEELWLENEKKCAVVRKSKQGRKRQELLAVAFGV
     37-217: Missing.
     331-377: DGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDAAK → E

Show »
Length:241
Mass (Da):27,951
Checksum:iD1E415379991433D
GO
Isoform 7 (identifier: P52757-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MAASSNSSLS...REVENRPKYY → MFSEELWLEN...PPLKLFACSQ
     57-192: Missing.
     331-377: DGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDAAK → E

Show »
Length:286
Mass (Da):33,075
Checksum:i8831F1DAC250619E
GO
Isoform 8 (identifier: P52757-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-192: Missing.

Show »
Length:324
Mass (Da):37,199
Checksum:i9E131257B687487F
GO
Isoform Beta-3 (identifier: P52757-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MAASSNSSLSGSSVS → MTQTHRAKSA...FADGLHSSCT

Show »
Length:543
Mass (Da):62,441
Checksum:i5EDA9330E0F66530
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 9 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B3VCF6B3VCF6_HUMAN
Beta chimaerin isoform B1-CHNdel ex...
CHN2
197Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B3VCF5B3VCF5_HUMAN
Beta chimaerin isoform B1-CHNdel ex...
CHN2
260Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C0V3H7C0V3_HUMAN
Beta-chimaerin
CHN2
180Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B3VCF4B3VCF4_HUMAN
Beta chimaerin isoform B1-CHNdel ex...
CHN2
228Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C138H7C138_HUMAN
Beta-chimaerin
CHN2
91Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B3VCG5B3VCG5_HUMAN
Beta chimaerin isoform B2-CHNdel ex...
CHN2
216Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
B8ZZU1B8ZZU1_HUMAN
Beta-chimaerin
CHN2
174Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JQ94C9JQ94_HUMAN
Beta-chimaerin
CHN2
187Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YG02H0YG02_HUMAN
Beta-chimaerin
CHN2
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1 – 6MAASSN → MRLL in AAA16836 (PubMed:8175705).Curated6
Sequence conflicti1 – 6MAASSN → MRLL in AAA19191 (PubMed:8175705).Curated6

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_022118204H → R1 PublicationCorresponds to variant dbSNP:rs3750103Ensembl.1
Natural variantiVAR_049136438P → S. Corresponds to variant dbSNP:rs34971642Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0462711 – 56MAASS…RPKYY → MFSEELWLENEKKCAVVRKS KQGRKRQELLAVAFGVKVGV KGGFLWPPLKLFACSQ in isoform 3, isoform 5 and isoform 7. 2 PublicationsAdd BLAST56
Alternative sequenceiVSP_0476001 – 36MAASS…QLQQE → MFSEELWLENEKKCAVVRKS KQGRKRQELLAVAFGV in isoform 4 and isoform 6. 2 PublicationsAdd BLAST36
Alternative sequenceiVSP_0536791 – 15MAASS…GSSVS → MTQTHRAKSASSCPNLLVPE TWPHQVSASHAGRSKQPQGG ILKINEEHRRGAIQDLLASP GFTFGKRVVFDSHCLKRQHT FADGLHSSCT in isoform Beta-3. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_04760137 – 217Missing in isoform 4 and isoform 6. 2 PublicationsAdd BLAST181
Alternative sequenceiVSP_05332349 – 192Missing in isoform 8. 1 PublicationAdd BLAST144
Alternative sequenceiVSP_04627257 – 192Missing in isoform 3, isoform 5 and isoform 7. 2 PublicationsAdd BLAST136
Alternative sequenceiVSP_047602247 – 304Missing in isoform 5. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_047603331 – 377DGEKA…IDAAK → E in isoform 6 and isoform 7. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L29126 mRNA Translation: AAA19191.1
U07223 mRNA Translation: AAA16836.1
U28926 mRNA Translation: AAA86528.1
EU732752 mRNA Translation: ACF04989.1
EU732753 mRNA Translation: ACF04990.1
EU732754 mRNA Translation: ACF04991.1
EU732758 mRNA Translation: ACF04995.1
EU732762 mRNA Translation: ACF04999.1
GQ924106 mRNA Translation: ADK47390.1
AK026415 mRNA No translation available.
AK313021 mRNA Translation: BAG35856.1
AK316030 mRNA Translation: BAH14401.1
AC004417 Genomic DNA Translation: AAC06177.1
AC004593 Genomic DNA No translation available.
AC005232 Genomic DNA No translation available.
AC007096 Genomic DNA No translation available.
AC007255 Genomic DNA Translation: AAS07498.1
CH236948 Genomic DNA Translation: EAL24205.1
CH471073 Genomic DNA Translation: EAW93919.1
BC112155 mRNA Translation: AAI12156.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47566.1 [P52757-3]
CCDS5420.1 [P52757-1]
CCDS78219.1 [P52757-5]
CCDS87488.1 [P52757-9]

Protein sequence database of the Protein Information Resource

More...
PIRi
A53764

NCBI Reference Sequences

More...
RefSeqi
NP_001035025.1, NM_001039936.2 [P52757-3]
NP_001279998.1, NM_001293069.1 [P52757-9]
NP_001279999.1, NM_001293070.1
NP_001280000.1, NM_001293071.1
NP_001280002.1, NM_001293073.1 [P52757-4]
NP_001280004.1, NM_001293075.1 [P52757-6]
NP_001280005.1, NM_001293076.1 [P52757-5]
NP_001280006.1, NM_001293077.1
NP_001280007.1, NM_001293078.1
NP_001280008.1, NM_001293079.1
NP_001280009.1, NM_001293080.1 [P52757-7]
NP_004058.1, NM_004067.3 [P52757-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.654611
Hs.710429
Hs.734596

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000222792; ENSP00000222792; ENSG00000106069 [P52757-1]
ENST00000412711; ENSP00000486515; ENSG00000106069 [P52757-3]
ENST00000421775; ENSP00000394284; ENSG00000106069 [P52757-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1124

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1124

UCSC genome browser

More...
UCSCi
uc003szz.4 human [P52757-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L29126 mRNA Translation: AAA19191.1
U07223 mRNA Translation: AAA16836.1
U28926 mRNA Translation: AAA86528.1
EU732752 mRNA Translation: ACF04989.1
EU732753 mRNA Translation: ACF04990.1
EU732754 mRNA Translation: ACF04991.1
EU732758 mRNA Translation: ACF04995.1
EU732762 mRNA Translation: ACF04999.1
GQ924106 mRNA Translation: ADK47390.1
AK026415 mRNA No translation available.
AK313021 mRNA Translation: BAG35856.1
AK316030 mRNA Translation: BAH14401.1
AC004417 Genomic DNA Translation: AAC06177.1
AC004593 Genomic DNA No translation available.
AC005232 Genomic DNA No translation available.
AC007096 Genomic DNA No translation available.
AC007255 Genomic DNA Translation: AAS07498.1
CH236948 Genomic DNA Translation: EAL24205.1
CH471073 Genomic DNA Translation: EAW93919.1
BC112155 mRNA Translation: AAI12156.1
CCDSiCCDS47566.1 [P52757-3]
CCDS5420.1 [P52757-1]
CCDS78219.1 [P52757-5]
CCDS87488.1 [P52757-9]
PIRiA53764
RefSeqiNP_001035025.1, NM_001039936.2 [P52757-3]
NP_001279998.1, NM_001293069.1 [P52757-9]
NP_001279999.1, NM_001293070.1
NP_001280000.1, NM_001293071.1
NP_001280002.1, NM_001293073.1 [P52757-4]
NP_001280004.1, NM_001293075.1 [P52757-6]
NP_001280005.1, NM_001293076.1 [P52757-5]
NP_001280006.1, NM_001293077.1
NP_001280007.1, NM_001293078.1
NP_001280008.1, NM_001293079.1
NP_001280009.1, NM_001293080.1 [P52757-7]
NP_004058.1, NM_004067.3 [P52757-1]
UniGeneiHs.654611
Hs.710429
Hs.734596

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XA6X-ray3.20A7-468[»]
ProteinModelPortaliP52757
SMRiP52757
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107548, 9 interactors
IntActiP52757, 14 interactors
MINTiP52757
STRINGi9606.ENSP00000222792

Chemistry databases

BindingDBiP52757
ChEMBLiCHEMBL4504

PTM databases

iPTMnetiP52757
PhosphoSitePlusiP52757

Polymorphism and mutation databases

BioMutaiCHN2
DMDMi2506455

Proteomic databases

PaxDbiP52757
PeptideAtlasiP52757
PRIDEiP52757
ProteomicsDBi56529

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000222792; ENSP00000222792; ENSG00000106069 [P52757-1]
ENST00000412711; ENSP00000486515; ENSG00000106069 [P52757-3]
ENST00000421775; ENSP00000394284; ENSG00000106069 [P52757-5]
GeneIDi1124
KEGGihsa:1124
UCSCiuc003szz.4 human [P52757-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1124
DisGeNETi1124
EuPathDBiHostDB:ENSG00000106069.20

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CHN2
HGNCiHGNC:1944 CHN2
HPAiHPA018989
MIMi602857 gene
neXtProtiNX_P52757
OpenTargetsiENSG00000106069
PharmGKBiPA26474

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1453 Eukaryota
ENOG410YM3I LUCA
GeneTreeiENSGT00940000153726
HOGENOMiHOG000231926
HOVERGENiHBG080489
InParanoidiP52757
KOiK20630
OMAiIICPGEV
OrthoDBiEOG091G0834
PhylomeDBiP52757
TreeFamiTF342052

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle
SignaLinkiP52757
SIGNORiP52757

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CHN2 human
EvolutionaryTraceiP52757

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Chimerin_2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1124

Protein Ontology

More...
PROi
PR:P52757

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000106069 Expressed in 204 organ(s), highest expression level in cerebellar vermis
CleanExiHS_CHN2
ExpressionAtlasiP52757 baseline and differential
GenevisibleiP52757 HS

Family and domain databases

CDDicd00029 C1, 1 hit
cd04372 RhoGAP_chimaerin, 1 hit
cd10352 SH2_a2chimerin_b2chimerin, 1 hit
Gene3Di1.10.555.10, 1 hit
3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR035840 Chimaerin_SH2
IPR017356 CHN1/CHN2
IPR020454 DAG/PE-bd
IPR002219 PE/DAG-bd
IPR008936 Rho_GTPase_activation_prot
IPR037860 RhoGAP_chimaerin
IPR000198 RhoGAP_dom
IPR000980 SH2
IPR036860 SH2_dom_sf
PfamiView protein in Pfam
PF00130 C1_1, 1 hit
PF00620 RhoGAP, 1 hit
PF00017 SH2, 1 hit
PIRSFiPIRSF038015 N-chimaerin, 1 hit
PRINTSiPR00008 DAGPEDOMAIN
SMARTiView protein in SMART
SM00109 C1, 1 hit
SM00324 RhoGAP, 1 hit
SM00252 SH2, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
SSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS50238 RHOGAP, 1 hit
PS50001 SH2, 1 hit
PS00479 ZF_DAG_PE_1, 1 hit
PS50081 ZF_DAG_PE_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCHIO_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P52757
Secondary accession number(s): A4D1A2
, B3VCF1, B3VCF2, B3VCF3, B3VCF7, B3VCG1, C9J7B0, E9PGE0, F8QPL9, Q2M203, Q75MM2
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: November 1, 1997
Last modified: December 5, 2018
This is version 186 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again