Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 186 (13 Feb 2019)
Sequence version 3 (23 Jan 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Rho GDP-dissociation inhibitor 1

Gene

ARHGDIA

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Controls Rho proteins homeostasis. Regulates the GDP/GTP exchange reaction of the Rho proteins by inhibiting the dissociation of GDP from them, and the subsequent binding of GTP to them. Retains Rho proteins such as CDC42, RAC1 and RHOA in an inactive cytosolic pool, regulating their stability and protecting them from degradation. Actively involved in the recycling and distribution of activated Rho GTPases in the cell, mediates extraction from membranes of both inactive and activated molecules due its exceptionally high affinity for prenylated forms. Through the modulation of Rho proteins, may play a role in cell motility regulation. In glioma cells, inhibits cell migration and invasion by mediating the signals of SEMA5A and PLXNB3 that lead to inactivation of RAC1.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • GTPase activator activity Source: UniProtKB-KW
  • Rac GTPase binding Source: GO_Central
  • Rho GDP-dissociation inhibitor activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-193634 Axonal growth inhibition (RHOA activation)
R-HSA-194840 Rho GTPase cycle
R-HSA-209563 Axonal growth stimulation

SIGNOR Signaling Network Open Resource

More...
SIGNORi
P52565

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Rho GDP-dissociation inhibitor 1
Short name:
Rho GDI 1
Alternative name(s):
Rho-GDI alpha
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ARHGDIA
Synonyms:GDIA1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000141522.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:678 ARHGDIA

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
601925 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P52565

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Nephrotic syndrome 8 (NPHS8)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of nephrotic syndrome, a renal disease clinically characterized by progressive renal failure, severe proteinuria, hypoalbuminemia, hyperlipidemia and edema. Kidney biopsies show diffuse mesangial sclerosis, with small glomeruli, hypercellularity, increased extracellular matrix, and contracted/collapsed glomerular tufts surrounded by immature or abnormal podocytes.
See also OMIM:615244
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_069814185Missing in NPHS8; produces mislocalization into the nucleus, hyperactivation of Rho-GTPases RHOA, RAC1 and CDC42 and impaired cell motility. 1 Publication1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi45D → A: Loss of RHOA interaction; when associated with A-185. 1 Publication1
Mutagenesisi185D → A: Loss of RHOA interaction; when associated with A-45. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...
DisGeNETi
396

MalaCards human disease database

More...
MalaCardsi
ARHGDIA
MIMi615244 phenotype

Open Targets

More...
OpenTargetsi
ENSG00000141522

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
93217 Familial idiopathic steroid-resistant nephrotic syndrome with diffuse mesangial sclerosis

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24963

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL3638327

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ARHGDIA

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1707892

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedCombined sources1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002190132 – 204Rho GDP-dissociation inhibitor 1Add BLAST203

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineCombined sources1 Publication1
Modified residuei34PhosphoserineBy similarity1
Modified residuei43N6-acetyllysineBy similarity1
Modified residuei47PhosphoserineCombined sources1
Modified residuei105N6-acetyllysineCombined sources1
Modified residuei127N6-acetyllysineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki138Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki138Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei141N6-acetyllysine; alternateCombined sources1
Modified residuei141N6-succinyllysine; alternateBy similarity1
Cross-linki141Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1); alternateCombined sources
Cross-linki141Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei178N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P52565

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P52565

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P52565

PeptideAtlas

More...
PeptideAtlasi
P52565

PRoteomics IDEntifications database

More...
PRIDEi
P52565

ProteomicsDB human proteome resource

More...
ProteomicsDBi
56489

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P52565-1 [P52565-1]

2D gel databases

DOSAC-COBS 2D-PAGE database

More...
DOSAC-COBS-2DPAGEi
P52565

USC-OGP 2-DE database

More...
OGPi
P52565

REPRODUCTION-2DPAGE

More...
REPRODUCTION-2DPAGEi
IPI00003815

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P52565

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P52565

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P52565

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000141522 Expressed in 227 organ(s), highest expression level in ectocervix

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P52565 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P52565 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB010005
HPA021407

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer (By similarity). Interacts with FER (PubMed:21122136). Interacts with PLXNB3 (By similarity). Forms a heterodimer with RAC1 (PubMed:23434736). Interacts with RHOA, the affinity is increased by three orders of magnitude when RHOA is prenylated (PubMed:20628200, PubMed:20400958, PubMed:23434736). Interacts with PSMD10; the interaction increases ARHGDIA association with RHOA, leading to ARHGDIA-mediated inactivation of RHOA and ROCK and prolonged AKT activation (PubMed:20628200). Interacts with KANK2; the interaction is direct and may regulate the interaction of ARHGDIA with RHOA, RAC1 and CDC42 (PubMed:25961457). Interacts with RHOC (PubMed:20400958). Interacts with CDC42 (PubMed:23434736).By similarity5 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
106889, 105 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
P52565

Protein interaction database and analysis system

More...
IntActi
P52565, 42 interactors

Molecular INTeraction database

More...
MINTi
P52565

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000269321

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1204
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CC0X-ray5.00E/F1-204[»]
1FSOX-ray2.00A67-204[»]
1FSTX-ray2.70A/B24-204[»]
1FT0X-ray2.60A/B67-204[»]
1FT3X-ray2.80A/B67-204[»]
1HH4X-ray2.70D/E1-204[»]
1KMTX-ray1.30A/B67-204[»]
1QVYX-ray1.60A/B/C/D67-204[»]
1RHOX-ray2.50A/B/C59-203[»]
2BXWX-ray2.40A/B67-204[»]
2JHSX-ray1.95A67-202[»]
2JHTX-ray1.88A/B/C/D67-202[»]
2JHUX-ray1.65A/B67-202[»]
2JHVX-ray2.07A/B/C/D/E/F67-202[»]
2JHWX-ray2.50A/B67-202[»]
2JHXX-ray1.60A/B67-202[»]
2JHYX-ray1.90A67-202[»]
2JHZX-ray2.20A/B67-202[»]
2JI0X-ray2.10A67-202[»]
2N80NMR-B31-204[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P52565

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P52565

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P52565

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the Rho GDI family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3205 Eukaryota
ENOG4111K44 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000006233

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000175765

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG000206

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P52565

KEGG Orthology (KO)

More...
KOi
K12462

Identification of Orthologs from Complete Genome Data

More...
OMAi
EGVEYQI

Database of Orthologous Groups

More...
OrthoDBi
1265661at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P52565

TreeFam database of animal gene trees

More...
TreeFami
TF105387

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.70.50.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR014756 Ig_E-set
IPR000406 Rho_GDI
IPR024792 RhoGDI_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10980 PTHR10980, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02115 Rho_GDI, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00492 RHOGDI

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF81296 SSF81296, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P52565-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAEQEPTAEQ LAQIAAENEE DEHSVNYKPP AQKSIQEIQE LDKDDESLRK
60 70 80 90 100
YKEALLGRVA VSADPNVPNV VVTGLTLVCS SAPGPLELDL TGDLESFKKQ
110 120 130 140 150
SFVLKEGVEY RIKISFRVNR EIVSGMKYIQ HTYRKGVKID KTDYMVGSYG
160 170 180 190 200
PRAEEYEFLT PVEEAPKGML ARGSYSIKSR FTDDDKTDHL SWEWNLTIKK

DWKD
Length:204
Mass (Da):23,207
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i59CB6F42E3B3BCCA
GO
Isoform 2 (identifier: P52565-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     139-183: IDKTDYMVGSYGPRAEEYEFLTPVEEAPKGMLARGSYSIKSRFTD → N

Show »
Length:160
Mass (Da):18,233
Checksum:i0E14B24C9B7AFCA2
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
J3QQX2J3QQX2_HUMAN
Rho GDP-dissociation inhibitor 1
ARHGDIA
235Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRY1J3KRY1_HUMAN
Rho GDP-dissociation inhibitor 1
ARHGDIA
249Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KRE2J3KRE2_HUMAN
Rho GDP-dissociation inhibitor 1
ARHGDIA
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KTF8J3KTF8_HUMAN
Rho GDP-dissociation inhibitor 1
ARHGDIA
193Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
J3KS60J3KS60_HUMAN
Rho GDP-dissociation inhibitor 1
ARHGDIA
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti139I → V in CAA45344 (Ref. 3) Curated1
Sequence conflicti139I → V in BAG35268 (PubMed:14702039).Curated1
Sequence conflicti188D → R AA sequence (Ref. 13) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_069814185Missing in NPHS8; produces mislocalization into the nucleus, hyperactivation of Rho-GTPases RHOA, RAC1 and CDC42 and impaired cell motility. 1 Publication1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_046699139 – 183IDKTD…SRFTD → N in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X69550 mRNA Translation: CAA49281.1
D13989 mRNA Translation: BAA03096.1
M97579 mRNA Translation: AAA36566.1
X63863 Genomic DNA Translation: CAA45344.1
AK300816 mRNA Translation: BAG62471.1
AK312347 mRNA Translation: BAG35268.1
AF498926 mRNA Translation: AAM21074.1
BT006884 mRNA Translation: AAP35530.1
CR456777 mRNA Translation: CAG33058.1
AC145207 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89697.1
BC005851 mRNA Translation: AAH05851.1
BC005875 mRNA Translation: AAH05875.1
BC008701 mRNA Translation: AAH08701.1
BC009759 mRNA Translation: AAH09759.1
BC016031 mRNA Translation: AAH16031.1
BC016185 mRNA Translation: AAH16185.1
BC024258 mRNA Translation: AAH24258.1
BC027730 mRNA Translation: AAH27730.1
BC075827 mRNA Translation: AAH75827.1
BC106044 mRNA Translation: AAI06045.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS11788.1 [P52565-1]
CCDS58609.1 [P52565-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
I38156

NCBI Reference Sequences

More...
RefSeqi
NP_001172006.1, NM_001185077.2 [P52565-1]
NP_001172007.1, NM_001185078.2 [P52565-2]
NP_001288169.1, NM_001301240.1
NP_001288170.1, NM_001301241.1
NP_001288171.1, NM_001301242.1
NP_001288172.1, NM_001301243.1
NP_004300.1, NM_004309.5 [P52565-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.159161
Hs.599508
Hs.728006

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000269321; ENSP00000269321; ENSG00000141522 [P52565-1]
ENST00000400721; ENSP00000383556; ENSG00000141522 [P52565-2]
ENST00000541078; ENSP00000441348; ENSG00000141522 [P52565-1]
ENST00000580685; ENSP00000464205; ENSG00000141522 [P52565-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
396

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:396

UCSC genome browser

More...
UCSCi
uc021ufg.2 human [P52565-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X69550 mRNA Translation: CAA49281.1
D13989 mRNA Translation: BAA03096.1
M97579 mRNA Translation: AAA36566.1
X63863 Genomic DNA Translation: CAA45344.1
AK300816 mRNA Translation: BAG62471.1
AK312347 mRNA Translation: BAG35268.1
AF498926 mRNA Translation: AAM21074.1
BT006884 mRNA Translation: AAP35530.1
CR456777 mRNA Translation: CAG33058.1
AC145207 Genomic DNA No translation available.
CH471099 Genomic DNA Translation: EAW89697.1
BC005851 mRNA Translation: AAH05851.1
BC005875 mRNA Translation: AAH05875.1
BC008701 mRNA Translation: AAH08701.1
BC009759 mRNA Translation: AAH09759.1
BC016031 mRNA Translation: AAH16031.1
BC016185 mRNA Translation: AAH16185.1
BC024258 mRNA Translation: AAH24258.1
BC027730 mRNA Translation: AAH27730.1
BC075827 mRNA Translation: AAH75827.1
BC106044 mRNA Translation: AAI06045.1
CCDSiCCDS11788.1 [P52565-1]
CCDS58609.1 [P52565-2]
PIRiI38156
RefSeqiNP_001172006.1, NM_001185077.2 [P52565-1]
NP_001172007.1, NM_001185078.2 [P52565-2]
NP_001288169.1, NM_001301240.1
NP_001288170.1, NM_001301241.1
NP_001288171.1, NM_001301242.1
NP_001288172.1, NM_001301243.1
NP_004300.1, NM_004309.5 [P52565-1]
UniGeneiHs.159161
Hs.599508
Hs.728006

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1CC0X-ray5.00E/F1-204[»]
1FSOX-ray2.00A67-204[»]
1FSTX-ray2.70A/B24-204[»]
1FT0X-ray2.60A/B67-204[»]
1FT3X-ray2.80A/B67-204[»]
1HH4X-ray2.70D/E1-204[»]
1KMTX-ray1.30A/B67-204[»]
1QVYX-ray1.60A/B/C/D67-204[»]
1RHOX-ray2.50A/B/C59-203[»]
2BXWX-ray2.40A/B67-204[»]
2JHSX-ray1.95A67-202[»]
2JHTX-ray1.88A/B/C/D67-202[»]
2JHUX-ray1.65A/B67-202[»]
2JHVX-ray2.07A/B/C/D/E/F67-202[»]
2JHWX-ray2.50A/B67-202[»]
2JHXX-ray1.60A/B67-202[»]
2JHYX-ray1.90A67-202[»]
2JHZX-ray2.20A/B67-202[»]
2JI0X-ray2.10A67-202[»]
2N80NMR-B31-204[»]
ProteinModelPortaliP52565
SMRiP52565
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi106889, 105 interactors
ELMiP52565
IntActiP52565, 42 interactors
MINTiP52565
STRINGi9606.ENSP00000269321

Chemistry databases

ChEMBLiCHEMBL3638327

PTM databases

iPTMnetiP52565
PhosphoSitePlusiP52565
SwissPalmiP52565

Polymorphism and mutation databases

BioMutaiARHGDIA
DMDMi1707892

2D gel databases

DOSAC-COBS-2DPAGEiP52565
OGPiP52565
REPRODUCTION-2DPAGEiIPI00003815

Proteomic databases

EPDiP52565
jPOSTiP52565
PaxDbiP52565
PeptideAtlasiP52565
PRIDEiP52565
ProteomicsDBi56489
TopDownProteomicsiP52565-1 [P52565-1]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
396
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000269321; ENSP00000269321; ENSG00000141522 [P52565-1]
ENST00000400721; ENSP00000383556; ENSG00000141522 [P52565-2]
ENST00000541078; ENSP00000441348; ENSG00000141522 [P52565-1]
ENST00000580685; ENSP00000464205; ENSG00000141522 [P52565-1]
GeneIDi396
KEGGihsa:396
UCSCiuc021ufg.2 human [P52565-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
396
DisGeNETi396
EuPathDBiHostDB:ENSG00000141522.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ARHGDIA
HGNCiHGNC:678 ARHGDIA
HPAiCAB010005
HPA021407
MalaCardsiARHGDIA
MIMi601925 gene
615244 phenotype
neXtProtiNX_P52565
OpenTargetsiENSG00000141522
Orphaneti93217 Familial idiopathic steroid-resistant nephrotic syndrome with diffuse mesangial sclerosis
PharmGKBiPA24963

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3205 Eukaryota
ENOG4111K44 LUCA
GeneTreeiENSGT00390000006233
HOGENOMiHOG000175765
HOVERGENiHBG000206
InParanoidiP52565
KOiK12462
OMAiEGVEYQI
OrthoDBi1265661at2759
PhylomeDBiP52565
TreeFamiTF105387

Enzyme and pathway databases

ReactomeiR-HSA-193634 Axonal growth inhibition (RHOA activation)
R-HSA-194840 Rho GTPase cycle
R-HSA-209563 Axonal growth stimulation
SIGNORiP52565

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ARHGDIA human
EvolutionaryTraceiP52565

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ARHGDIA

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
396

Protein Ontology

More...
PROi
PR:P52565

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000141522 Expressed in 227 organ(s), highest expression level in ectocervix
ExpressionAtlasiP52565 baseline and differential
GenevisibleiP52565 HS

Family and domain databases

Gene3Di2.70.50.30, 1 hit
InterProiView protein in InterPro
IPR014756 Ig_E-set
IPR000406 Rho_GDI
IPR024792 RhoGDI_dom_sf
PANTHERiPTHR10980 PTHR10980, 1 hit
PfamiView protein in Pfam
PF02115 Rho_GDI, 1 hit
PRINTSiPR00492 RHOGDI
SUPFAMiSSF81296 SSF81296, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGDIR1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P52565
Secondary accession number(s): A8MXW0
, B2R5X1, B4DDD3, B4DUV9, Q6IBM5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 23, 2007
Last modified: February 13, 2019
This is version 186 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again