Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 149 (18 Sep 2019)
Sequence version 2 (16 Aug 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

ATP-dependent 6-phosphofructokinase

Gene

Pfk

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.UniRule annotation2 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the ‘Function’ section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

Mg2+UniRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes regulatory mechanisms for enzymes, transporters or microbial transcription factors, and reports the components which regulate (by activation or inhibition) the reaction.<p><a href='/help/activity_regulation' target='_top'>More...</a></p>Activity regulationi

Allosterically activated by ADP, AMP, or fructose 2,6-bisphosphate, and allosterically inhibited by ATP or citrate.UniRule annotation

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: glycolysis

This protein is involved in step 3 of the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose.UniRule annotation
Proteins known to be involved in the 4 steps of the subpathway in this organism are:
  1. Phosphotransferase (Hex-C), Phosphotransferase (Hex-C), Phosphotransferase (Hex-A), Hexokinase type 2 (Hex-t2), Phosphotransferase (Hex-C), Hexokinase type 1 (Hex-t1), Phosphotransferase (Hex-t2-RA), Phosphotransferase (Hex-A), Phosphotransferase (Hex-C), Phosphotransferase (Hex-C), Phosphotransferase (Hex-A), Phosphotransferase (CG3001), Phosphotransferase (Hex-A), Phosphotransferase (CG3001), Phosphotransferase (Hex-C), Phosphotransferase (CG3001)
  2. Glucose-6-phosphate isomerase (Pgi)
  3. ATP-dependent 6-phosphofructokinase (Pfk), ATP-dependent 6-phosphofructokinase (Pfk), ATP-dependent 6-phosphofructokinase (Pfk-RB), ATP-dependent 6-phosphofructokinase (Pfk), ATP-dependent 6-phosphofructokinase (Pfk-RB), ATP-dependent 6-phosphofructokinase (Pfk-RC)
  4. Fructose-bisphosphate aldolase (Ald-RH), Fructose-bisphosphate aldolase (Ald1), Fructose-bisphosphate aldolase (Ald-RI), Fructose-bisphosphate aldolase (Ald1), Fructose-bisphosphate aldolase (Ald1), Fructose-bisphosphate aldolase (Ald)
This subpathway is part of the pathway glycolysis, which is itself part of Carbohydrate degradation.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes D-glyceraldehyde 3-phosphate and glycerone phosphate from D-glucose, the pathway glycolysis and in Carbohydrate degradation.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei27ATP; via amide nitrogenUniRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi121Magnesium; catalyticUniRule annotation1
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei168Proton acceptorUniRule annotation1
Binding sitei203Substrate; shared with dimeric partnerUniRule annotation1
Binding sitei266SubstrateUniRule annotation1
Binding sitei294Substrate; shared with dimeric partnerUniRule annotation1
Binding sitei480Allosteric activator fructose 2,6-bisphosphateUniRule annotation1
Binding sitei575Allosteric activator fructose 2,6-bisphosphate; shared with dimeric partnerUniRule annotation1
Binding sitei638Allosteric activator fructose 2,6-bisphosphateUniRule annotation1
Binding sitei664Allosteric activator fructose 2,6-bisphosphate; shared with dimeric partnerUniRule annotation1
Binding sitei745Allosteric activator fructose 2,6-bisphosphateUniRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi90 – 91ATPUniRule annotation2
Nucleotide bindingi120 – 123ATPUniRule annotation4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionAllosteric enzyme, Kinase, Transferase
Biological processGlycolysis
LigandATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-6798695 Neutrophil degranulation
R-DME-70171 Glycolysis

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00109;UER00182

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
ATP-dependent 6-phosphofructokinaseUniRule annotation (EC:2.7.1.11UniRule annotation)
Short name:
ATP-PFKUniRule annotation
Short name:
PhosphofructokinaseUniRule annotation
Alternative name(s):
PhosphohexokinaseUniRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Pfk
ORF Names:CG4001
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0003071 Pfk

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001120311 – 788ATP-dependent 6-phosphofructokinaseAdd BLAST788

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P52034

PRoteomics IDEntifications database

More...
PRIDEi
P52034

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Nearly 90% of the PFK activity in adults is localized to the thorax.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0003071 Expressed in 35 organ(s), highest expression level in head

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P52034 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P52034 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homotetramer.

UniRule annotation

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
61888, 4 interactors

Protein interaction database and analysis system

More...
IntActi
P52034, 2 interactors

Molecular INTeraction database

More...
MINTi
P52034

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0087506

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P52034

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 392N-terminal catalytic PFK domain 1Add BLAST392
Regioni166 – 168Substrate bindingUniRule annotation3
Regioni210 – 212Substrate bindingUniRule annotation3
Regioni300 – 303Substrate bindingUniRule annotation4
Regioni393 – 410Interdomain linkerAdd BLAST18
Regioni411 – 788C-terminal regulatory PFK domain 2Add BLAST378
Regioni537 – 541Allosteric activator fructose 2,6-bisphosphate bindingUniRule annotation5
Regioni582 – 584Allosteric activator fructose 2,6-bisphosphate bindingUniRule annotation3
Regioni670 – 673Allosteric activator fructose 2,6-bisphosphate bindingUniRule annotation4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2440 Eukaryota
COG0205 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000171778

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000148827

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P52034

KEGG Orthology (KO)

More...
KOi
K00850

Identification of Orthologs from Complete Genome Data

More...
OMAi
GCKAYFI

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P52034

Family and domain databases

HAMAP database of protein families

More...
HAMAPi
MF_03184 Phosphofructokinase_I_E, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR009161 6-Pfructokinase_euk
IPR022953 ATP_PFK
IPR015912 Phosphofructokinase_CS
IPR000023 Phosphofructokinase_dom
IPR035966 PKF_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00365 PFK, 2 hits

PIRSF; a whole-protein classification database

More...
PIRSFi
PIRSF000533 ATP_PFK_euk, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00476 PHFRCTKINASE

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF53784 SSF53784, 2 hits

TIGRFAMs; a protein family database

More...
TIGRFAMsi
TIGR02478 6PF1K_euk, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00433 PHOSPHOFRUCTOKINASE, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform B (identifier: P52034-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNSEINQRFL ARGSQKDKGL AVFTSGGDSQ GMNAAVRACV RMAIYLGCKV
60 70 80 90 100
YFIREGYQGM VDGGDCIQEA NWASVSSIIH RGGTIIGSAR CQDFRERQGR
110 120 130 140 150
LKAANNLIQR GITNLVVIGG DGSLTGANLF RQEWSSLLDE LVKNKTITTE
160 170 180 190 200
QQEKFNVLHI VGLVGSIDND FCGTDMTIGT DTALHRIIEA IDAISSTAYS
210 220 230 240 250
HQRTFIMEVM GRHCGYLALV GGLACEADFI FIPEMPPKVD WPDRLCSQLA
260 270 280 290 300
QERSAGQRLN IVIVAEGAMD REGHPITAED VKKVIDERLK HDARITVLGH
310 320 330 340 350
VQRGGNPSAF DRILACRMGA EATLALMEAT KDSVPVVISL DGNQAVRVPL
360 370 380 390 400
MECVERTQAV AKAMAEKRWA DAVKLRGRSF ERNLETYKML TRLKPPKENF
410 420 430 440 450
DADGKGIEGY RLAVMHIGAP ACGMNAAVRS FVRNAIYRGD VVYGINDGVE
460 470 480 490 500
GLIAGNVREL GWSDVSGWVG QGGAYLGTKR TLPEGKFKEI AARLKEFKIQ
510 520 530 540 550
GLLIIGGFES YHAAGQIADQ RDNYPQFCIP IVVIPSTISN NVPGTEFSLG
560 570 580 590 600
CDTGLNEITE ICDRIRQSAQ GTKRRVFVIE TMGGYCGYLA TLAGLAGGAD
610 620 630 640 650
AAYIYEEKFS IKDLQQDVYH MASKMAEGVS RGLILRNEKA SENYSTDFIY
660 670 680 690 700
RLYSEEGKGL FTCRMNILGH MQQGGSPTPF DRNMGTKMAA KCVDWLAAQI
710 720 730 740 750
KANIDANGVV NCKSPDTATL LGIVSRQYRF SPLVDLIAET NFDQRIPKKQ
760 770 780
WWLRLRPLLR ILAKHDSAYE EEGMYITVEE ECDTDAVA
Length:788
Mass (Da):86,648
Last modified:August 16, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBE45A03013299B75
GO
Isoform A (identifier: P52034-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: MNSEINQRFLARGSQ → MHSIKFRVFT...IDFVHPVKPF

Note: No experimental confirmation available.
Show »
Length:950
Mass (Da):105,187
Checksum:i28BD631321945759
GO
Isoform C (identifier: P52034-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     219-250: LVGGLACEADFIFIPEMPPKVDWPDRLCSQLA → ISAAIATEADFMFIPEEPVSVNWKDEICVKLH

Note: No experimental confirmation available.
Show »
Length:788
Mass (Da):86,720
Checksum:iD4E991EADAD0B084
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4K7L1A0A0B4K7L1_DROME
ATP-dependent 6-phosphofructokinase
Pfk BcDNA.GH12192, BcDNA:GH12192, Dmel\CG4001, l(2)06339, PFK
950Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0B4KFI7A0A0B4KFI7_DROME
ATP-dependent 6-phosphofructokinase
Pfk BcDNA.GH12192, BcDNA:GH12192, Dmel\CG4001, l(2)06339, PFK
922Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAN71109 differs from that shown. Reason: Frameshift at position 218.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti68 – 70QEA → RKS in AAA62385 (PubMed:7929140).Curated3
Sequence conflicti80 – 92HRGGT…SARCQ → PFVGWHHPLLRPLP (PubMed:7929140).CuratedAdd BLAST13
Sequence conflicti130 – 131FR → LP in AAA62385 (PubMed:7929140).Curated2
Sequence conflicti160 – 161IV → ML in AAA62385 (PubMed:7929140).Curated2
Sequence conflicti190 – 199AIDAISSTAY → QSKAKVQSPVQPN in AAA62385 (PubMed:7929140).Curated10
Sequence conflicti209 – 212VMGR → GQVS in AAA62385 (PubMed:7929140).Curated4
Sequence conflicti228 – 252DFIFI…QLAQE → IHIHPNAPGRLGQTGSALSW TQ in AAA62385 (PubMed:7929140).CuratedAdd BLAST25
Sequence conflicti313I → F in AAA62385 (PubMed:7929140).Curated1
Sequence conflicti322 – 325ATLA → PLWP in AAA62385 (PubMed:7929140).Curated4
Sequence conflicti360 – 361VA → G in AAA62385 (PubMed:7929140).Curated2
Sequence conflicti374 – 375KL → NV in AAA62385 (PubMed:7929140).Curated2
Sequence conflicti455G → R in AAA62385 (PubMed:7929140).Curated1
Sequence conflicti478T → S in AAA62385 (PubMed:7929140).Curated1
Sequence conflicti522 – 526DNYPQ → TTTHS in AAA62385 (PubMed:7929140).Curated5
Sequence conflicti590 – 591AT → PP in AAA62385 (PubMed:7929140).Curated2
Sequence conflicti613D → E in AAA62385 (PubMed:7929140).Curated1
Sequence conflicti622 – 636ASKMA…GLILR → PPRWPRRLPRSNPA in AAA62385 (PubMed:7929140).CuratedAdd BLAST15
Sequence conflicti695 – 705WLAAQIKANID → CWPPRSRRTST in AAA62385 (PubMed:7929140).CuratedAdd BLAST11

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0149501 – 15MNSEI…ARGSQ → MHSIKFRVFTKLKPIFLEIN GRIPICRHFHGPTTFRLEIS NKTPPIRQKLTFPNIGIQCT RSHHLCCPRDISGNTLLSVK FNCKRHCIKLRSDSGDQKND SPGEKNIQKDKSAQRCGKPI NNLHNGFLNAVNYSEKNAVK KKKSAPKRKCGKSVDELRKC LRTMQDVIDFVHPVKPF in isoform A. 1 PublicationAdd BLAST15
Alternative sequenceiVSP_014951219 – 250LVGGL…CSQLA → ISAAIATEADFMFIPEEPVS VNWKDEICVKLH in isoform C. 1 PublicationAdd BLAST32

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
L27653 Genomic DNA Translation: AAA62385.1
AE013599 Genomic DNA Translation: AAF58840.1
AE013599 Genomic DNA Translation: AAF58841.1
AE013599 Genomic DNA Translation: AAM71065.2
AF145673 mRNA Translation: AAD38648.1
BT001354 mRNA Translation: AAN71109.1 Frameshift.

Protein sequence database of the Protein Information Resource

More...
PIRi
A55034

NCBI Reference Sequences

More...
RefSeqi
NP_523676.1, NM_078952.3 [P52034-2]
NP_724890.1, NM_165746.3 [P52034-1]
NP_724891.2, NM_165747.4 [P52034-3]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0088420; FBpp0087506; FBgn0003071 [P52034-2]
FBtr0088421; FBpp0087507; FBgn0003071 [P52034-3]
FBtr0088422; FBpp0087508; FBgn0003071 [P52034-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
36060

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG4001

UCSC genome browser

More...
UCSCi
CG4001-RA d. melanogaster [P52034-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L27653 Genomic DNA Translation: AAA62385.1
AE013599 Genomic DNA Translation: AAF58840.1
AE013599 Genomic DNA Translation: AAF58841.1
AE013599 Genomic DNA Translation: AAM71065.2
AF145673 mRNA Translation: AAD38648.1
BT001354 mRNA Translation: AAN71109.1 Frameshift.
PIRiA55034
RefSeqiNP_523676.1, NM_078952.3 [P52034-2]
NP_724890.1, NM_165746.3 [P52034-1]
NP_724891.2, NM_165747.4 [P52034-3]

3D structure databases

SMRiP52034
ModBaseiSearch...

Protein-protein interaction databases

BioGridi61888, 4 interactors
IntActiP52034, 2 interactors
MINTiP52034
STRINGi7227.FBpp0087506

Proteomic databases

PaxDbiP52034
PRIDEiP52034

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsemblMetazoaiFBtr0088420; FBpp0087506; FBgn0003071 [P52034-2]
FBtr0088421; FBpp0087507; FBgn0003071 [P52034-3]
FBtr0088422; FBpp0087508; FBgn0003071 [P52034-1]
GeneIDi36060
KEGGidme:Dmel_CG4001
UCSCiCG4001-RA d. melanogaster [P52034-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
36060
FlyBaseiFBgn0003071 Pfk

Phylogenomic databases

eggNOGiKOG2440 Eukaryota
COG0205 LUCA
GeneTreeiENSGT00940000171778
HOGENOMiHOG000148827
InParanoidiP52034
KOiK00850
OMAiGCKAYFI
PhylomeDBiP52034

Enzyme and pathway databases

UniPathwayiUPA00109;UER00182
ReactomeiR-DME-6798695 Neutrophil degranulation
R-DME-70171 Glycolysis

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
36060

Protein Ontology

More...
PROi
PR:P52034

Gene expression databases

BgeeiFBgn0003071 Expressed in 35 organ(s), highest expression level in head
ExpressionAtlasiP52034 baseline and differential
GenevisibleiP52034 DM

Family and domain databases

HAMAPiMF_03184 Phosphofructokinase_I_E, 1 hit
InterProiView protein in InterPro
IPR009161 6-Pfructokinase_euk
IPR022953 ATP_PFK
IPR015912 Phosphofructokinase_CS
IPR000023 Phosphofructokinase_dom
IPR035966 PKF_sf
PfamiView protein in Pfam
PF00365 PFK, 2 hits
PIRSFiPIRSF000533 ATP_PFK_euk, 1 hit
PRINTSiPR00476 PHFRCTKINASE
SUPFAMiSSF53784 SSF53784, 2 hits
TIGRFAMsiTIGR02478 6PF1K_euk, 1 hit
PROSITEiView protein in PROSITE
PS00433 PHOSPHOFRUCTOKINASE, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPFKA_DROME
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P52034
Secondary accession number(s): Q8IH94
, Q8MKV4, Q9V5G7, Q9Y100
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: August 16, 2005
Last modified: September 18, 2019
This is version 149 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again