Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ubiquitin-conjugating enzyme E2 E1

Gene

UBE2E1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. Catalyzes the covalent attachment of ISG15 to other proteins. Mediates the selective degradation of short-lived and abnormal proteins. In vitro also catalyzes 'Lys-48'-linked polyubiquitination.2 Publications

Catalytic activityi

S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [E2 ubiquitin-conjugating enzyme]-L-cysteine = [E1 ubiquitin-activating enzyme]-L-cysteine + S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine.PROSITE-ProRule annotation1 Publication
S-ubiquitinyl-[E1 ubiquitin-activating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E1 ubiquitin-activating enzyme]-L-cysteine + N6-monoubiquitinyl-[acceptor protein]-L-lysine.1 Publication

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.PROSITE-ProRule annotation
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei131Glycyl thioester intermediatePROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDAi2.3.2.B6 2681
ReactomeiR-HSA-1169408 ISG15 antiviral mechanism
R-HSA-141430 Inactivation of APC/C via direct inhibition of the APC/C complex
R-HSA-174048 APC/C:Cdc20 mediated degradation of Cyclin B
R-HSA-174084 Autodegradation of Cdh1 by Cdh1:APC/C
R-HSA-174154 APC/C:Cdc20 mediated degradation of Securin
R-HSA-174178 APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
R-HSA-174184 Cdc20:Phospho-APC/C mediated degradation of Cyclin A
R-HSA-176407 Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
R-HSA-176408 Regulation of APC/C activators between G1/S and early anaphase
R-HSA-176409 APC/C:Cdc20 mediated degradation of mitotic proteins
R-HSA-176412 Phosphorylation of the APC/C
R-HSA-179409 APC-Cdc20 mediated degradation of Nek2A
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2559582 Senescence-Associated Secretory Phenotype (SASP)
R-HSA-69017 CDK-mediated phosphorylation and removal of Cdc6
R-HSA-8866652 Synthesis of active ubiquitin: roles of E1 and E2 enzymes
R-HSA-8866654 E3 ubiquitin ligases ubiquitinate target proteins
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiP51965
UniPathwayi
UPA00143

Protein family/group databases

MoonDBiP51965 Predicted

Names & Taxonomyi

Protein namesi
Recommended name:
Ubiquitin-conjugating enzyme E2 E1 (EC:2.3.2.231 Publication)
Alternative name(s):
(E3-independent) E2 ubiquitin-conjugating enzyme E1 (EC:2.3.2.241 Publication)
E2 ubiquitin-conjugating enzyme E1
UbcH6
Ubiquitin carrier protein E1
Ubiquitin-protein ligase E1
Gene namesi
Name:UBE2E1
Synonyms:UBCH6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000170142.11
HGNCiHGNC:12477 UBE2E1
MIMi602916 gene
neXtProtiNX_P51965

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi7324
OpenTargetsiENSG00000170142
PharmGKBiPA37127

Polymorphism and mutation databases

BioMutaiUBE2E1
DMDMi1717857

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources
ChainiPRO_00000824702 – 193Ubiquitin-conjugating enzyme E2 E1Add BLAST192

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylserineCombined sources1
Cross-linki136Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ISG15)

Post-translational modificationi

ISGylation suppresses ubiquitin E2 enzyme activity.1 Publication
Autoubiquitinated in vitro.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Ubl conjugation

Proteomic databases

EPDiP51965
MaxQBiP51965
PaxDbiP51965
PeptideAtlasiP51965
PRIDEiP51965
ProteomicsDBi12713
56463

PTM databases

iPTMnetiP51965
PhosphoSitePlusiP51965

Expressioni

Gene expression databases

BgeeiENSG00000170142 Expressed in 236 organ(s), highest expression level in embryo
CleanExiHS_UBE2E1
ExpressionAtlasiP51965 baseline and differential
GenevisibleiP51965 HS

Organism-specific databases

HPAiCAB073413
HPA030445

Interactioni

Subunit structurei

Interacts with RNF14.

Binary interactionsi

Protein-protein interaction databases

BioGridi113172, 132 interactors
CORUMiP51965
IntActiP51965, 68 interactors
MINTiP51965
STRINGi9606.ENSP00000303709

Structurei

Secondary structure

1193
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliP51965
SMRiP51965
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiP51965

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi9 – 18Poly-Ser10

Sequence similaritiesi

Belongs to the ubiquitin-conjugating enzyme family.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0417 Eukaryota
COG5078 LUCA
GeneTreeiENSGT00910000143990
HOGENOMiHOG000233455
HOVERGENiHBG063308
InParanoidiP51965
KOiK20217
OMAiETERSSN
OrthoDBiEOG091G0GF8
PhylomeDBiP51965
TreeFamiTF101117

Family and domain databases

CDDicd00195 UBCc, 1 hit
Gene3Di3.10.110.10, 1 hit
InterProiView protein in InterPro
IPR000608 UBQ-conjugat_E2
IPR023313 UBQ-conjugating_AS
IPR016135 UBQ-conjugating_enzyme/RWD
PfamiView protein in Pfam
PF00179 UQ_con, 1 hit
SUPFAMiSSF54495 SSF54495, 1 hit
PROSITEiView protein in PROSITE
PS00183 UBIQUITIN_CONJUGAT_1, 1 hit
PS50127 UBIQUITIN_CONJUGAT_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P51965-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSDDDSRAST SSSSSSSSNQ QTEKETNTPK KKESKVSMSK NSKLLSTSAK
60 70 80 90 100
RIQKELADIT LDPPPNCSAG PKGDNIYEWR STILGPPGSV YEGGVFFLDI
110 120 130 140 150
TFTPEYPFKP PKVTFRTRIY HCNINSQGVI CLDILKDNWS PALTISKVLL
160 170 180 190
SICSLLTDCN PADPLVGSIA TQYMTNRAEH DRMARQWTKR YAT
Length:193
Mass (Da):21,404
Last modified:October 1, 1996 - v1
Checksum:i2FBC50BE2A6A0008
GO
Isoform 2 (identifier: P51965-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: MSDDDSRASTSSSSSSSSNQQTEKETNTPKKKESKVSMSKNSKLLSTSAK → MKEVGRPREVRGRPGKS

Note: No experimental confirmation available.
Show »
Length:160
Mass (Da):18,000
Checksum:i412FAB80EBA7A2A7
GO
Isoform 3 (identifier: P51965-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     51-67: Missing.

Note: No experimental confirmation available.
Show »
Length:176
Mass (Da):19,499
Checksum:i4CFBF51A6FB61C8C
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z306B7Z306_HUMAN
Ubiquitin-conjugating enzyme E2 E1
UBE2E1
167Annotation score:
C9J2P0C9J2P0_HUMAN
Ubiquitin-conjugating enzyme E2 E1
UBE2E1
147Annotation score:
H7C061H7C061_HUMAN
Ubiquitin-conjugating enzyme E2 E1
UBE2E1
151Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti131C → R in BI223271 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_06186825E → D. Corresponds to variant dbSNP:rs36060625Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0458841 – 50MSDDD…STSAK → MKEVGRPREVRGRPGKS in isoform 2. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_04720051 – 67Missing in isoform 3. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X92963 mRNA Translation: CAA63539.1
AK314854 mRNA Translation: BAG37371.1
AC020626 Genomic DNA No translation available.
AC124914 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64329.1
CH471055 Genomic DNA Translation: EAW64331.1
CH471055 Genomic DNA Translation: EAW64332.1
BC009139 mRNA Translation: AAH09139.1
BI223271 mRNA No translation available.
BI666638 mRNA No translation available.
CCDSiCCDS2638.1 [P51965-1]
CCDS2639.1 [P51965-3]
CCDS56244.1 [P51965-2]
RefSeqiNP_001189405.1, NM_001202476.1 [P51965-2]
NP_003332.1, NM_003341.4 [P51965-1]
NP_872607.1, NM_182666.2 [P51965-3]
UniGeneiHs.164853

Genome annotation databases

EnsembliENST00000306627; ENSP00000303709; ENSG00000170142 [P51965-1]
ENST00000346855; ENSP00000329113; ENSG00000170142 [P51965-3]
ENST00000424381; ENSP00000411351; ENSG00000170142 [P51965-2]
GeneIDi7324
KEGGihsa:7324
UCSCiuc003cch.4 human [P51965-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X92963 mRNA Translation: CAA63539.1
AK314854 mRNA Translation: BAG37371.1
AC020626 Genomic DNA No translation available.
AC124914 Genomic DNA No translation available.
CH471055 Genomic DNA Translation: EAW64329.1
CH471055 Genomic DNA Translation: EAW64331.1
CH471055 Genomic DNA Translation: EAW64332.1
BC009139 mRNA Translation: AAH09139.1
BI223271 mRNA No translation available.
BI666638 mRNA No translation available.
CCDSiCCDS2638.1 [P51965-1]
CCDS2639.1 [P51965-3]
CCDS56244.1 [P51965-2]
RefSeqiNP_001189405.1, NM_001202476.1 [P51965-2]
NP_003332.1, NM_003341.4 [P51965-1]
NP_872607.1, NM_182666.2 [P51965-3]
UniGeneiHs.164853

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XR9X-ray1.79C83-91[»]
3BZHX-ray1.60A1-193[»]
4JJQX-ray1.95B5-14[»]
5LBNX-ray1.42A37-193[»]
ProteinModelPortaliP51965
SMRiP51965
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi113172, 132 interactors
CORUMiP51965
IntActiP51965, 68 interactors
MINTiP51965
STRINGi9606.ENSP00000303709

Protein family/group databases

MoonDBiP51965 Predicted

PTM databases

iPTMnetiP51965
PhosphoSitePlusiP51965

Polymorphism and mutation databases

BioMutaiUBE2E1
DMDMi1717857

Proteomic databases

EPDiP51965
MaxQBiP51965
PaxDbiP51965
PeptideAtlasiP51965
PRIDEiP51965
ProteomicsDBi12713
56463

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306627; ENSP00000303709; ENSG00000170142 [P51965-1]
ENST00000346855; ENSP00000329113; ENSG00000170142 [P51965-3]
ENST00000424381; ENSP00000411351; ENSG00000170142 [P51965-2]
GeneIDi7324
KEGGihsa:7324
UCSCiuc003cch.4 human [P51965-1]

Organism-specific databases

CTDi7324
DisGeNETi7324
EuPathDBiHostDB:ENSG00000170142.11
GeneCardsiUBE2E1
HGNCiHGNC:12477 UBE2E1
HPAiCAB073413
HPA030445
MIMi602916 gene
neXtProtiNX_P51965
OpenTargetsiENSG00000170142
PharmGKBiPA37127
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0417 Eukaryota
COG5078 LUCA
GeneTreeiENSGT00910000143990
HOGENOMiHOG000233455
HOVERGENiHBG063308
InParanoidiP51965
KOiK20217
OMAiETERSSN
OrthoDBiEOG091G0GF8
PhylomeDBiP51965
TreeFamiTF101117

Enzyme and pathway databases

UniPathwayi
UPA00143

BRENDAi2.3.2.B6 2681
ReactomeiR-HSA-1169408 ISG15 antiviral mechanism
R-HSA-141430 Inactivation of APC/C via direct inhibition of the APC/C complex
R-HSA-174048 APC/C:Cdc20 mediated degradation of Cyclin B
R-HSA-174084 Autodegradation of Cdh1 by Cdh1:APC/C
R-HSA-174154 APC/C:Cdc20 mediated degradation of Securin
R-HSA-174178 APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
R-HSA-174184 Cdc20:Phospho-APC/C mediated degradation of Cyclin A
R-HSA-176407 Conversion from APC/C:Cdc20 to APC/C:Cdh1 in late anaphase
R-HSA-176408 Regulation of APC/C activators between G1/S and early anaphase
R-HSA-176409 APC/C:Cdc20 mediated degradation of mitotic proteins
R-HSA-176412 Phosphorylation of the APC/C
R-HSA-179409 APC-Cdc20 mediated degradation of Nek2A
R-HSA-2467813 Separation of Sister Chromatids
R-HSA-2559582 Senescence-Associated Secretory Phenotype (SASP)
R-HSA-69017 CDK-mediated phosphorylation and removal of Cdc6
R-HSA-8866652 Synthesis of active ubiquitin: roles of E1 and E2 enzymes
R-HSA-8866654 E3 ubiquitin ligases ubiquitinate target proteins
R-HSA-983168 Antigen processing: Ubiquitination & Proteasome degradation
SignaLinkiP51965

Miscellaneous databases

ChiTaRSiUBE2E1 human
EvolutionaryTraceiP51965
GeneWikiiUBE2E1
GenomeRNAii7324
PROiPR:P51965
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000170142 Expressed in 236 organ(s), highest expression level in embryo
CleanExiHS_UBE2E1
ExpressionAtlasiP51965 baseline and differential
GenevisibleiP51965 HS

Family and domain databases

CDDicd00195 UBCc, 1 hit
Gene3Di3.10.110.10, 1 hit
InterProiView protein in InterPro
IPR000608 UBQ-conjugat_E2
IPR023313 UBQ-conjugating_AS
IPR016135 UBQ-conjugating_enzyme/RWD
PfamiView protein in Pfam
PF00179 UQ_con, 1 hit
SUPFAMiSSF54495 SSF54495, 1 hit
PROSITEiView protein in PROSITE
PS00183 UBIQUITIN_CONJUGAT_1, 1 hit
PS50127 UBIQUITIN_CONJUGAT_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiUB2E1_HUMAN
AccessioniPrimary (citable) accession number: P51965
Secondary accession number(s): B2RBX4, C9J8K2, K4DI90
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: November 7, 2018
This is version 185 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  7. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again