Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cyclin-F

Gene

Ccnf

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of CP110 during G2 phase, thereby acting as an inhibitor of centrosome reduplication.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionCyclin
Biological processCell cycle, Cell division, Mitosis, Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-MMU-8951664 Neddylation
R-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation

Names & Taxonomyi

Protein namesi
Recommended name:
Cyclin-F
Gene namesi
Name:Ccnf
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 17

Organism-specific databases

MGIiMGI:102551 Ccnf

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Disruption phenotypei

Death by embryonic day 10.5 (E10.5), with many developmental anomalies due in part to failures in yolk sac and chorioallantoic placentation. Heterozygous mice are normal and fertile.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000804641 – 777Cyclin-FAdd BLAST777

Post-translational modificationi

Degraded when the spindle assembly checkpoint is activated during the G2-M transition. Degradation is not dependent on the proteasome or ubiquitin and depends on the C-terminal PEST sequence (By similarity).By similarity
Phosphorylated just before cells enter into mitosis.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiP51944
PRIDEiP51944

PTM databases

iPTMnetiP51944
PhosphoSitePlusiP51944

Expressioni

Inductioni

Expression is activated by the FOXM1 transcription factor.2 Publications

Gene expression databases

BgeeiENSMUSG00000072082 Expressed in 169 organ(s), highest expression level in liver
CleanExiMM_CCNF
GenevisibleiP51944 MM

Interactioni

Subunit structurei

Component of the SCF(CCNF) complex consisting of CUL1, RBX1, SKP1 and CCNF. Interacts with CCNB1; interaction is required for nuclear localization of CCNB1. Interacts with CCP110; this interaction leads to CCP110 ubiquitination and degradation via the proteasome pathway (By similarity).By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000111048

Structurei

3D structure databases

ProteinModelPortaliP51944
SMRiP51944
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini29 – 76F-boxPROSITE-ProRule annotationAdd BLAST48
Domaini295 – 405Cyclin N-terminalAdd BLAST111

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni582 – 761PESTAdd BLAST180

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi20 – 28Nuclear localization signal 1By similarity9
Motifi568 – 574Nuclear localization signal 2By similarity7

Domaini

The nuclear localization signals mediate the localization to the nucleus and are required for CCNB1 localization to the nucleus.By similarity

Sequence similaritiesi

Belongs to the cyclin family. Cyclin AB subfamily.Curated

Phylogenomic databases

eggNOGiKOG0654 Eukaryota
COG5024 LUCA
GeneTreeiENSGT00810000125541
HOVERGENiHBG050838
InParanoidiP51944
KOiK10289
OMAiLHQKCFH
OrthoDBiEOG091G0AU2
PhylomeDBiP51944
TreeFamiTF101006

Family and domain databases

CDDicd00043 CYCLIN, 1 hit
Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR028857 CCNF_metazoan
IPR039361 Cyclin
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR004367 Cyclin_C-dom
IPR006671 Cyclin_N
IPR036047 F-box-like_dom_sf
IPR001810 F-box_dom
IPR011990 TPR-like_helical_dom_sf
PANTHERiPTHR10177 PTHR10177, 1 hit
PTHR10177:SF252 PTHR10177:SF252, 1 hit
PfamiView protein in Pfam
PF02984 Cyclin_C, 1 hit
PF00134 Cyclin_N, 1 hit
PF00646 F-box, 1 hit
SMARTiView protein in SMART
SM00385 CYCLIN, 2 hits
SM01332 Cyclin_C, 1 hit
SM00256 FBOX, 1 hit
SUPFAMiSSF47954 SSF47954, 2 hits
SSF81383 SSF81383, 1 hit
PROSITEiView protein in PROSITE
PS00292 CYCLINS, 1 hit
PS50181 FBOX, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P51944-1) [UniParc]FASTAAdd to basket
Also known as: Short

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSGGVIHCR CAKCFCYPTK RRIKRRPRNL TILSLPEDVL FHILKWLSVG
60 70 80 90 100
DILAVRAVHS HLKYLVDNHA SVWASASFQE LWPSPQNLKL FERAAEKGNF
110 120 130 140 150
EAAVKLGIAY LYNEGLSVSD EACAEVNGLK ASRFFSMAER LNTGSEPFIW
160 170 180 190 200
LFIRPPWSVS GSCCKAVVHD SLRAECQLQR SHKASILHCL GRVLNLFEDE
210 220 230 240 250
EKRKQARSLL EESSRQGCLI SSYLLWESDR KVDMSDPGRC LHSFRKLRDY
260 270 280 290 300
AAKGCWEAQL ALAKACAGGS QLGLEGKACS ESVCQLFQAS QAVNKQQIFS
310 320 330 340 350
VQKGLSDTMR YILIDWLVEV ATMKDFTSLC LHLTVECVDR YLRRRLVPRY
360 370 380 390 400
KLQLLGIACM VICTRFISKE ILTIREAVWL TDNTYKYEDL VRVMGEIISA
410 420 430 440 450
LEGKIRIPTV VDYKEVLLTL VPVAPRTQHL CSFLCELTLL HTSLSIYAPA
460 470 480 490 500
RLASAALLLA RLMHGQTQPW TTHLWDLTGF SYSDLVPCVL SLHKKCFHDD
510 520 530 540 550
APKDYRQVSL TAVKQRFEDK CYEEISREEV LSYADLCSTI GVKQESPEPP
560 570 580 590 600
SFPSSGEIHT FLSSPSGRRS KRKRENSLQE DRGSFVTTPT AELSNQEETL
610 620 630 640 650
LGSLLDWSLE CCSGYEGDQE SEGEKEGDVT APSRLLDVTV VYLNPEEHCC
660 670 680 690 700
QESSDEEAWP EDKIHPAPGT QAPPASAPRP LLCNRGDRAK DITTSGYSSV
710 720 730 740 750
SSSSPISSLD GGMGGSPQST SVLSVGSHSS TKPCHHQAKK SCLQCRPPNS
760 770
PESGVHQQPV KRQNLSVHSD KDMHLAS
Length:777
Mass (Da):86,623
Last modified:October 5, 2010 - v2
Checksum:i1FDA471590793DD6
GO
Isoform 2 (identifier: P51944-2) [UniParc]FASTAAdd to basket
Also known as: Long

The sequence of this isoform differs from the canonical sequence as follows:
     5-5: G → GGECWRDGVGDRSYGTEAGGAWTRAPVTRECASHPPKHGV

Show »
Length:816
Mass (Da):90,759
Checksum:iC6B4284932DDD381
GO
Isoform 3 (identifier: P51944-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-233: Missing.

Note: No experimental confirmation available.
Show »
Length:775
Mass (Da):86,409
Checksum:i3AFF206EED11CF53
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti81L → P in AAA62317 (Ref. 2) Curated1
Sequence conflicti81L → P in AAA63152 (Ref. 2) Curated1
Sequence conflicti92E → Q in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti132S → T in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti247L → H in BAC26886 (PubMed:16141072).Curated1
Sequence conflicti263A → T in AAA62317 (Ref. 2) Curated1
Sequence conflicti263A → T in AAA63152 (Ref. 2) Curated1
Sequence conflicti290S → T in AAA62317 (Ref. 2) Curated1
Sequence conflicti290S → T in AAA63152 (Ref. 2) Curated1
Sequence conflicti301V → G in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti364T → S in AAA62317 (Ref. 2) Curated1
Sequence conflicti364T → S in AAA63152 (Ref. 2) Curated1
Sequence conflicti454S → A in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti464H → R in AAA62317 (Ref. 2) Curated1
Sequence conflicti464H → R in AAA63152 (Ref. 2) Curated1
Sequence conflicti508V → I in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti508V → I in AAA62317 (Ref. 2) Curated1
Sequence conflicti508V → I in AAA63152 (Ref. 2) Curated1
Sequence conflicti508V → I in AAH37662 (PubMed:15489334).Curated1
Sequence conflicti527R → Q in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti539T → A in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti539T → A in AAA62317 (Ref. 2) Curated1
Sequence conflicti539T → A in AAA63152 (Ref. 2) Curated1
Sequence conflicti539T → A in AAH37662 (PubMed:15489334).Curated1
Sequence conflicti567G → E in AAA62317 (Ref. 2) Curated1
Sequence conflicti567G → E in AAA63152 (Ref. 2) Curated1
Sequence conflicti568 – 569RR → E in CAA87695 (PubMed:7767003).Curated2
Sequence conflicti603S → G in AAA62317 (Ref. 2) Curated1
Sequence conflicti603S → G in AAA63152 (Ref. 2) Curated1
Sequence conflicti624E → R in AAA62317 (Ref. 2) Curated1
Sequence conflicti624E → R in AAA63152 (Ref. 2) Curated1
Sequence conflicti757Q → K in BAE41025 (PubMed:16141072).Curated1
Sequence conflicti773M → T in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti773M → T in AAA62317 (Ref. 2) Curated1
Sequence conflicti773M → T in AAA63152 (Ref. 2) Curated1
Sequence conflicti773M → T in AAH37662 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0012575G → GGECWRDGVGDRSYGTEAGG AWTRAPVTRECASHPPKHGV in isoform 2. 1 Publication1
Alternative sequenceiVSP_039778232 – 233Missing in isoform 3. 1 Publication2

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z47766 mRNA Translation: CAA87695.1
U20612 mRNA Translation: AAA62317.1
U20636 mRNA Translation: AAA63152.1
AK030298 mRNA Translation: BAC26886.1
AK082485 mRNA Translation: BAC38507.1
AK159594 mRNA Translation: BAE35214.1
AK169263 mRNA Translation: BAE41025.1
AC117577 Genomic DNA No translation available.
BC037662 mRNA Translation: AAH37662.1
CCDSiCCDS37484.1 [P51944-1]
PIRiI48317
RefSeqiNP_031660.3, NM_007634.4 [P51944-1]
UniGeneiMm.77695

Genome annotation databases

EnsembliENSMUST00000115390; ENSMUSP00000111048; ENSMUSG00000072082 [P51944-1]
GeneIDi12449
KEGGimmu:12449
UCSCiuc008ave.1 mouse [P51944-1]
uc008avg.1 mouse [P51944-3]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z47766 mRNA Translation: CAA87695.1
U20612 mRNA Translation: AAA62317.1
U20636 mRNA Translation: AAA63152.1
AK030298 mRNA Translation: BAC26886.1
AK082485 mRNA Translation: BAC38507.1
AK159594 mRNA Translation: BAE35214.1
AK169263 mRNA Translation: BAE41025.1
AC117577 Genomic DNA No translation available.
BC037662 mRNA Translation: AAH37662.1
CCDSiCCDS37484.1 [P51944-1]
PIRiI48317
RefSeqiNP_031660.3, NM_007634.4 [P51944-1]
UniGeneiMm.77695

3D structure databases

ProteinModelPortaliP51944
SMRiP51944
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000111048

PTM databases

iPTMnetiP51944
PhosphoSitePlusiP51944

Proteomic databases

PaxDbiP51944
PRIDEiP51944

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000115390; ENSMUSP00000111048; ENSMUSG00000072082 [P51944-1]
GeneIDi12449
KEGGimmu:12449
UCSCiuc008ave.1 mouse [P51944-1]
uc008avg.1 mouse [P51944-3]

Organism-specific databases

CTDi899
MGIiMGI:102551 Ccnf

Phylogenomic databases

eggNOGiKOG0654 Eukaryota
COG5024 LUCA
GeneTreeiENSGT00810000125541
HOVERGENiHBG050838
InParanoidiP51944
KOiK10289
OMAiLHQKCFH
OrthoDBiEOG091G0AU2
PhylomeDBiP51944
TreeFamiTF101006

Enzyme and pathway databases

ReactomeiR-MMU-8951664 Neddylation
R-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

PROiPR:P51944
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000072082 Expressed in 169 organ(s), highest expression level in liver
CleanExiMM_CCNF
GenevisibleiP51944 MM

Family and domain databases

CDDicd00043 CYCLIN, 1 hit
Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR028857 CCNF_metazoan
IPR039361 Cyclin
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR004367 Cyclin_C-dom
IPR006671 Cyclin_N
IPR036047 F-box-like_dom_sf
IPR001810 F-box_dom
IPR011990 TPR-like_helical_dom_sf
PANTHERiPTHR10177 PTHR10177, 1 hit
PTHR10177:SF252 PTHR10177:SF252, 1 hit
PfamiView protein in Pfam
PF02984 Cyclin_C, 1 hit
PF00134 Cyclin_N, 1 hit
PF00646 F-box, 1 hit
SMARTiView protein in SMART
SM00385 CYCLIN, 2 hits
SM01332 Cyclin_C, 1 hit
SM00256 FBOX, 1 hit
SUPFAMiSSF47954 SSF47954, 2 hits
SSF81383 SSF81383, 1 hit
PROSITEiView protein in PROSITE
PS00292 CYCLINS, 1 hit
PS50181 FBOX, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCCNF_MOUSE
AccessioniPrimary (citable) accession number: P51944
Secondary accession number(s): Q3TF73
, Q60797, Q60799, Q8BSX9, Q8C4D9, Q8CI26
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 5, 2010
Last modified: November 7, 2018
This is version 140 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again