Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 146 (16 Oct 2019)
Sequence version 2 (05 Oct 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Cyclin-F

Gene

Ccnf

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of CP110 during G2 phase, thereby acting as an inhibitor of centrosome reduplication.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionCyclin
Biological processCell cycle, Cell division, Mitosis, Ubl conjugation pathway

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-8951664 Neddylation
R-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Cyclin-F
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ccnf
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:102551 Ccnf

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Death by embryonic day 10.5 (E10.5), with many developmental anomalies due in part to failures in yolk sac and chorioallantoic placentation. Heterozygous mice are normal and fertile.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000804641 – 777Cyclin-FAdd BLAST777

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Degraded when the spindle assembly checkpoint is activated during the G2-M transition. Degradation is not dependent on the proteasome or ubiquitin and depends on the C-terminal PEST sequence (By similarity).By similarity
Phosphorylated just before cells enter into mitosis.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P51944

PRoteomics IDEntifications database

More...
PRIDEi
P51944

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P51944

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P51944

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Expression is activated by the FOXM1 transcription factor.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000072082 Expressed in 169 organ(s), highest expression level in liver

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P51944 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of the SCF(CCNF) complex consisting of CUL1, RBX1, SKP1 and CCNF.

Interacts with CCNB1; interaction is required for nuclear localization of CCNB1.

Interacts with CCP110; this interaction leads to CCP110 ubiquitination and degradation via the proteasome pathway (By similarity).

By similarity

GO - Molecular functioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000111048

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P51944

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini29 – 76F-boxPROSITE-ProRule annotationAdd BLAST48
Domaini295 – 405Cyclin N-terminalAdd BLAST111

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni582 – 761PESTAdd BLAST180

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi20 – 28Nuclear localization signal 1By similarity9
Motifi568 – 574Nuclear localization signal 2By similarity7

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The nuclear localization signals mediate the localization to the nucleus and are required for CCNB1 localization to the nucleus.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the cyclin family. Cyclin AB subfamily.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0654 Eukaryota
COG5024 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00810000125541

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P51944

KEGG Orthology (KO)

More...
KOi
K10289

Identification of Orthologs from Complete Genome Data

More...
OMAi
VHCRCSK

Database of Orthologous Groups

More...
OrthoDBi
607108at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P51944

TreeFam database of animal gene trees

More...
TreeFami
TF101006

Family and domain databases

Conserved Domains Database

More...
CDDi
cd00043 CYCLIN, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028857 CCNF_metazoan
IPR039361 Cyclin
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR004367 Cyclin_C-dom
IPR006671 Cyclin_N
IPR036047 F-box-like_dom_sf
IPR001810 F-box_dom
IPR011990 TPR-like_helical_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR10177 PTHR10177, 1 hit
PTHR10177:SF252 PTHR10177:SF252, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02984 Cyclin_C, 1 hit
PF00134 Cyclin_N, 1 hit
PF00646 F-box, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00385 CYCLIN, 2 hits
SM01332 Cyclin_C, 1 hit
SM00256 FBOX, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47954 SSF47954, 2 hits
SSF81383 SSF81383, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00292 CYCLINS, 1 hit
PS50181 FBOX, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P51944-1) [UniParc]FASTAAdd to basket
Also known as: Short

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGSGGVIHCR CAKCFCYPTK RRIKRRPRNL TILSLPEDVL FHILKWLSVG
60 70 80 90 100
DILAVRAVHS HLKYLVDNHA SVWASASFQE LWPSPQNLKL FERAAEKGNF
110 120 130 140 150
EAAVKLGIAY LYNEGLSVSD EACAEVNGLK ASRFFSMAER LNTGSEPFIW
160 170 180 190 200
LFIRPPWSVS GSCCKAVVHD SLRAECQLQR SHKASILHCL GRVLNLFEDE
210 220 230 240 250
EKRKQARSLL EESSRQGCLI SSYLLWESDR KVDMSDPGRC LHSFRKLRDY
260 270 280 290 300
AAKGCWEAQL ALAKACAGGS QLGLEGKACS ESVCQLFQAS QAVNKQQIFS
310 320 330 340 350
VQKGLSDTMR YILIDWLVEV ATMKDFTSLC LHLTVECVDR YLRRRLVPRY
360 370 380 390 400
KLQLLGIACM VICTRFISKE ILTIREAVWL TDNTYKYEDL VRVMGEIISA
410 420 430 440 450
LEGKIRIPTV VDYKEVLLTL VPVAPRTQHL CSFLCELTLL HTSLSIYAPA
460 470 480 490 500
RLASAALLLA RLMHGQTQPW TTHLWDLTGF SYSDLVPCVL SLHKKCFHDD
510 520 530 540 550
APKDYRQVSL TAVKQRFEDK CYEEISREEV LSYADLCSTI GVKQESPEPP
560 570 580 590 600
SFPSSGEIHT FLSSPSGRRS KRKRENSLQE DRGSFVTTPT AELSNQEETL
610 620 630 640 650
LGSLLDWSLE CCSGYEGDQE SEGEKEGDVT APSRLLDVTV VYLNPEEHCC
660 670 680 690 700
QESSDEEAWP EDKIHPAPGT QAPPASAPRP LLCNRGDRAK DITTSGYSSV
710 720 730 740 750
SSSSPISSLD GGMGGSPQST SVLSVGSHSS TKPCHHQAKK SCLQCRPPNS
760 770
PESGVHQQPV KRQNLSVHSD KDMHLAS
Length:777
Mass (Da):86,623
Last modified:October 5, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1FDA471590793DD6
GO
Isoform 2 (identifier: P51944-2) [UniParc]FASTAAdd to basket
Also known as: Long

The sequence of this isoform differs from the canonical sequence as follows:
     5-5: G → GGECWRDGVGDRSYGTEAGGAWTRAPVTRECASHPPKHGV

Show »
Length:816
Mass (Da):90,759
Checksum:iC6B4284932DDD381
GO
Isoform 3 (identifier: P51944-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     232-233: Missing.

Note: No experimental confirmation available.
Show »
Length:775
Mass (Da):86,409
Checksum:i3AFF206EED11CF53
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A3Q4EI70A0A3Q4EI70_MOUSE
Cyclin-F
Ccnf
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti81L → P in AAA62317 (Ref. 2) Curated1
Sequence conflicti81L → P in AAA63152 (Ref. 2) Curated1
Sequence conflicti92E → Q in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti132S → T in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti247L → H in BAC26886 (PubMed:16141072).Curated1
Sequence conflicti263A → T in AAA62317 (Ref. 2) Curated1
Sequence conflicti263A → T in AAA63152 (Ref. 2) Curated1
Sequence conflicti290S → T in AAA62317 (Ref. 2) Curated1
Sequence conflicti290S → T in AAA63152 (Ref. 2) Curated1
Sequence conflicti301V → G in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti364T → S in AAA62317 (Ref. 2) Curated1
Sequence conflicti364T → S in AAA63152 (Ref. 2) Curated1
Sequence conflicti454S → A in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti464H → R in AAA62317 (Ref. 2) Curated1
Sequence conflicti464H → R in AAA63152 (Ref. 2) Curated1
Sequence conflicti508V → I in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti508V → I in AAA62317 (Ref. 2) Curated1
Sequence conflicti508V → I in AAA63152 (Ref. 2) Curated1
Sequence conflicti508V → I in AAH37662 (PubMed:15489334).Curated1
Sequence conflicti527R → Q in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti539T → A in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti539T → A in AAA62317 (Ref. 2) Curated1
Sequence conflicti539T → A in AAA63152 (Ref. 2) Curated1
Sequence conflicti539T → A in AAH37662 (PubMed:15489334).Curated1
Sequence conflicti567G → E in AAA62317 (Ref. 2) Curated1
Sequence conflicti567G → E in AAA63152 (Ref. 2) Curated1
Sequence conflicti568 – 569RR → E in CAA87695 (PubMed:7767003).Curated2
Sequence conflicti603S → G in AAA62317 (Ref. 2) Curated1
Sequence conflicti603S → G in AAA63152 (Ref. 2) Curated1
Sequence conflicti624E → R in AAA62317 (Ref. 2) Curated1
Sequence conflicti624E → R in AAA63152 (Ref. 2) Curated1
Sequence conflicti757Q → K in BAE41025 (PubMed:16141072).Curated1
Sequence conflicti773M → T in CAA87695 (PubMed:7767003).Curated1
Sequence conflicti773M → T in AAA62317 (Ref. 2) Curated1
Sequence conflicti773M → T in AAA63152 (Ref. 2) Curated1
Sequence conflicti773M → T in AAH37662 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0012575G → GGECWRDGVGDRSYGTEAGG AWTRAPVTRECASHPPKHGV in isoform 2. 1 Publication1
Alternative sequenceiVSP_039778232 – 233Missing in isoform 3. 1 Publication2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
Z47766 mRNA Translation: CAA87695.1
U20612 mRNA Translation: AAA62317.1
U20636 mRNA Translation: AAA63152.1
AK030298 mRNA Translation: BAC26886.1
AK082485 mRNA Translation: BAC38507.1
AK159594 mRNA Translation: BAE35214.1
AK169263 mRNA Translation: BAE41025.1
AC117577 Genomic DNA No translation available.
BC037662 mRNA Translation: AAH37662.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS37484.1 [P51944-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
I48317

NCBI Reference Sequences

More...
RefSeqi
NP_031660.3, NM_007634.4 [P51944-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000115390; ENSMUSP00000111048; ENSMUSG00000072082 [P51944-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
12449

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:12449

UCSC genome browser

More...
UCSCi
uc008ave.1 mouse [P51944-1]
uc008avg.1 mouse [P51944-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z47766 mRNA Translation: CAA87695.1
U20612 mRNA Translation: AAA62317.1
U20636 mRNA Translation: AAA63152.1
AK030298 mRNA Translation: BAC26886.1
AK082485 mRNA Translation: BAC38507.1
AK159594 mRNA Translation: BAE35214.1
AK169263 mRNA Translation: BAE41025.1
AC117577 Genomic DNA No translation available.
BC037662 mRNA Translation: AAH37662.1
CCDSiCCDS37484.1 [P51944-1]
PIRiI48317
RefSeqiNP_031660.3, NM_007634.4 [P51944-1]

3D structure databases

SMRiP51944
ModBaseiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000111048

PTM databases

iPTMnetiP51944
PhosphoSitePlusiP51944

Proteomic databases

PaxDbiP51944
PRIDEiP51944

Genome annotation databases

EnsembliENSMUST00000115390; ENSMUSP00000111048; ENSMUSG00000072082 [P51944-1]
GeneIDi12449
KEGGimmu:12449
UCSCiuc008ave.1 mouse [P51944-1]
uc008avg.1 mouse [P51944-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
899
MGIiMGI:102551 Ccnf

Phylogenomic databases

eggNOGiKOG0654 Eukaryota
COG5024 LUCA
GeneTreeiENSGT00810000125541
InParanoidiP51944
KOiK10289
OMAiVHCRCSK
OrthoDBi607108at2759
PhylomeDBiP51944
TreeFamiTF101006

Enzyme and pathway databases

ReactomeiR-MMU-8951664 Neddylation
R-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ccnf mouse

Protein Ontology

More...
PROi
PR:P51944

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000072082 Expressed in 169 organ(s), highest expression level in liver
GenevisibleiP51944 MM

Family and domain databases

CDDicd00043 CYCLIN, 1 hit
Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR028857 CCNF_metazoan
IPR039361 Cyclin
IPR013763 Cyclin-like
IPR036915 Cyclin-like_sf
IPR004367 Cyclin_C-dom
IPR006671 Cyclin_N
IPR036047 F-box-like_dom_sf
IPR001810 F-box_dom
IPR011990 TPR-like_helical_dom_sf
PANTHERiPTHR10177 PTHR10177, 1 hit
PTHR10177:SF252 PTHR10177:SF252, 1 hit
PfamiView protein in Pfam
PF02984 Cyclin_C, 1 hit
PF00134 Cyclin_N, 1 hit
PF00646 F-box, 1 hit
SMARTiView protein in SMART
SM00385 CYCLIN, 2 hits
SM01332 Cyclin_C, 1 hit
SM00256 FBOX, 1 hit
SUPFAMiSSF47954 SSF47954, 2 hits
SSF81383 SSF81383, 1 hit
PROSITEiView protein in PROSITE
PS00292 CYCLINS, 1 hit
PS50181 FBOX, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCCNF_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P51944
Secondary accession number(s): Q3TF73
, Q60797, Q60799, Q8BSX9, Q8C4D9, Q8CI26
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 5, 2010
Last modified: October 16, 2019
This is version 146 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again