UniProtKB - P51859 (HDGF_MOUSE)

BLAST

>sp|P51859|HDGF_MOUSE Hepatoma-derived growth factor OS=Mus musculus OX=10090 GN=Hdgf PE=1 SV=2
MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFFGTHETAFLGP
KDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQKKSCAAEPEVEPEAHE
GDGDKKGSAEGSSDEEGKLVIDEPAKEKNEKGTLKRRAGDVLEDSPKRPKESGDHEEEDK
EIAALEGERPLPVEVEKNSTPSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVRDHESL

Align
Format
Add to basket Added to basket
History
Entry version 156 (07 Nov 2018)
Sequence version 2 (13 Aug 2002)
Previous versions | rss
Other tutorials and videos
Help video
Feedback

Protein

Hepatoma-derived growth factor

Gene

Hdgf

Organism

Mus musculus (Mouse)

Status

Reviewed-Annotation score: -Experimental evidence at protein levelⁱ

Functionⁱ

Heparin-binding protein, with mitogenic activity for fibroblasts. Acts as a transcriptional repressor (By similarity).By similarity

Sites

Feature key	Position(s)	DescriptionActions	Length
Binding siteⁱ	19	HeparinBy similarity	1
Binding siteⁱ	21	HeparinBy similarity	1
Binding siteⁱ	72	HeparinBy similarity	1
Binding siteⁱ	75	HeparinBy similarity	1
Binding siteⁱ	79	HeparinBy similarity	1
Binding siteⁱ	80	HeparinBy similarity	1

GO - Molecular functionⁱ

growth factor activity
Source: MGI
Inferred from sequence orthologyⁱ
- 9299445
heparin binding Source: UniProtKB-KW
nucleotide binding Source: UniProtKB-KW
proximal promoter DNA-binding transcription repressor activity, RNA polymerase II-specific Source: MGI
RNA polymerase II proximal promoter sequence-specific DNA binding Source: MGI
transcription corepressor activity Source: MGI
transcription corepressor binding Source: MGI

View the complete GO annotation on QuickGO ...

GO - Biological processⁱ

cellular process
Source: MGI
Inferred from direct assayⁱ
- 15140875
negative regulation of transcription by RNA polymerase II Source: MGI
positive regulation of transcription by RNA polymerase II Source: MGI
protein localization to nucleus Source: MGI

View the complete GO annotation on QuickGO ...

Keywordsⁱ

Molecular function	DNA-binding, Growth factor, Heparin-binding, Repressor
Biological process	Transcription, Transcription regulation
Ligand	Nucleotide-binding

Names & Taxonomyⁱ

Protein namesⁱ	Recommended name: Hepatoma-derived growth factor Short name: HDGF
Gene namesⁱ	Name:Hdgf Synonyms:Tdrm1
Organismⁱ	Mus musculus (Mouse)
Taxonomic identifierⁱ	10090 [NCBI]
Taxonomic lineageⁱ	cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Glires › Rodentia › Myomorpha › Muroidea › Muridae › Murinae › Mus › Mus
Proteomesⁱ	UP000000589 Componentⁱ: Chromosome 3

Organism-specific databases

MGIⁱ	MGI:1194494 Hdgf

Keywords - Cellular componentⁱ

Cytoplasm, Nucleus

PTM / Processingⁱ

Molecule processing

Feature key	Position(s)	DescriptionActions	Graphical view	Length
ChainⁱPRO_0000191701	1 – 237	Hepatoma-derived growth factorAdd BLAST		237

Amino acid modifications

Feature key	Position(s)	DescriptionActions	Length
Modified residueⁱ	44	N6-acetyllysineBy similarity	1
Cross-linkⁱ	80	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternateBy similarity
Cross-linkⁱ	80	Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateBy similarity
Modified residueⁱ	128	PhosphoserineCombined sources	1
Modified residueⁱ	132	PhosphoserineCombined sources	1
Modified residueⁱ	133	PhosphoserineCombined sources	1
Modified residueⁱ	165	PhosphoserineCombined sources	1
Modified residueⁱ	199	PhosphoserineBy similarity	1
Modified residueⁱ	200	PhosphothreonineBy similarity	1
Modified residueⁱ	202	PhosphoserineCombined sources	1
Modified residueⁱ	206	PhosphoserineCombined sources	1
Modified residueⁱ	236	PhosphoserineBy similarity	1

Post-translational modificationⁱ

Sumoylated with SUMO1. Sumoylation prevents binding to chromatin (By similarity).By similarity

Keywords - PTMⁱ

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDⁱ	P51859
MaxQB - The MaxQuant DataBase More...MaxQBⁱ	P51859
PaxDbⁱ	P51859
PeptideAtlas More...PeptideAtlasⁱ	P51859
PRIDEⁱ	P51859
TopDownProteomicsⁱ	P51859

PTM databases

iPTMnetⁱ	P51859
PhosphoSitePlusⁱ	P51859
SwissPalmⁱ	P51859

Miscellaneous databases

PMAP-CutDBⁱ	P51859

PMAP-CutDBⁱ

P51859

Expressionⁱ

Tissue specificityⁱ

Expressed predominantly in testis and skeletal muscle, to intermediate extents in heart, brain, lung, liver, and kidney, and to a minimal extent in spleen.

Gene expression databases

Bgeeⁱ	ENSMUSG00000004897 Expressed in 316 organ(s), highest expression level in ear vesicle
CleanExⁱ	MM_HDGF
ExpressionAtlasⁱ	P51859 baseline and differential
Genevisibleⁱ	P51859 MM

Interactionⁱ

Subunit structureⁱ

Monomer, and domain-swapped homodimer.By similarity

Binary interactionsⁱ

With	Entry	#Exp.	IntAct
	Q3UMU9-1	4	EBI-2943087,EBI-7627862
	Q3UMU9-3	4	EBI-2943087,EBI-7627932
Hdgfl2	Q3UMU9	4	EBI-2943087,EBI-7627961

GO - Molecular functionⁱ

growth factor activity
Source: MGI
Inferred from sequence orthologyⁱ
- 9299445
transcription corepressor binding Source: MGI

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

BioGridⁱ	200265, 2 interactors
IntActⁱ	P51859, 8 interactors
Molecular INTeraction database More...MINTⁱ	P51859
STRINGⁱ	10090.ENSMUSP00000005017

Structureⁱ

3D structure databases

ProteinModelPortalⁱ	P51859
SMRⁱ	P51859
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Family & Domainsⁱ

Domains and Repeats

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Domainⁱ	12 – 69	PWWPPROSITE-ProRule annotationAdd BLAST		58

Motif

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Motifⁱ	75 – 80	Nuclear localization signalBy similarity		6
Motifⁱ	155 – 170	Bipartite nuclear localization signalBy similarityAdd BLAST		16

Compositional bias

Feature key	Position(s)	DescriptionActions	Graphical view	Length
Compositional biasⁱ	111 – 227	Glu-richAdd BLAST		117

Domainⁱ

The PWWP domain harbors the heparin-binding sites and is responsible for DNA-binding, while the C-terminal region is essentially unstructured.By similarity

Sequence similaritiesⁱ

Belongs to the HDGF family.Curated

Phylogenomic databases

eggNOGⁱ	ENOG410IMJ5 Eukaryota ENOG4111IFT LUCA
Ensembl GeneTree More...GeneTreeⁱ	ENSGT00530000063013
HOGENOMⁱ	HOG000112874
HOVERGENⁱ	HBG010574
InParanoidⁱ	P51859
KEGG Orthology (KO) More...KOⁱ	K16641
Database of Orthologous Groups More...OrthoDBⁱ	EOG091G045X
PhylomeDBⁱ	P51859
TreeFamⁱ	TF105385

Family and domain databases

Conserved Domains Database More...CDDⁱ	cd05834 HDGF_related, 1 hit
InterProⁱ	View protein in InterPro IPR035496 HDGF-rel_PWWP IPR000313 PWWP_dom
Pfam protein domain database More...Pfamⁱ	View protein in Pfam PF00855 PWWP, 1 hit
SMARTⁱ	View protein in SMART SM00293 PWWP, 1 hit
PROSITEⁱ	View protein in PROSITE PS50812 PWWP, 1 hit

Sequence (1+)ⁱ

Sequence statusⁱ: Complete.

This entry has 1 described isoform and 2 potential isoforms that are computationally mapped.Show all Align All

P51859-1 [UniParc]FASTA Add to basket

« Hide

        10         20         30         40         50
MSRSNRQKEY KCGDLVFAKM KGYPHWPARI DEMPEAAVKS TANKYQVFFF 
        60         70         80         90        100
GTHETAFLGP KDLFPYEESK EKFGKPNKRK GFSEGLWEIE NNPTVKASGY 
       110        120        130        140        150
QSSQKKSCAA EPEVEPEAHE GDGDKKGSAE GSSDEEGKLV IDEPAKEKNE 
       160        170        180        190        200
KGTLKRRAGD VLEDSPKRPK ESGDHEEEDK EIAALEGERP LPVEVEKNST 
       210        220        230 
PSEPDSGQGP PAEEEEGEEE AAKEEAEAQG VRDHESL

Length:237

Mass (Da):26,269

Last modified:August 13, 2002 - v2

Checksum:ⁱAAE4CF574DA4733F

Computationally mapped potential isoform sequencesⁱ

There are 2 potential isoforms mapped to this entry.BLAST Align Show all Add to basket

Entry	Entry name	Protein names	Gene names	Length	Annotation

E0CXA0	E0CXA0_MOUSE	Hepatoma-derived growth factor Hepatoma-derived growth factor	Hdgf	202	Annotation score:
E0CYW7	E0CYW7_MOUSE	Hepatoma-derived growth factor Hepatoma-derived growth factor	Hdgf	84	Annotation score:

Experimental Info

Feature key	Position(s)	DescriptionActions	Length
Sequence conflictⁱ	118	A → D in BAB30979 (PubMed:16141072).Curated	1
Sequence conflictⁱ	190	P → H in BAA09838 (PubMed:9299445).Curated	1
Sequence conflictⁱ	229	Q → E in BAC36126 (PubMed:16141072).Curated	1
Sequence conflictⁱ	229	Q → P in BAA09838 (PubMed:9299445).Curated	1

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	D63707 mRNA Translation: BAA09838.1 AF251787 mRNA Translation: AAF65469.1 AK017863 mRNA Translation: BAB30979.1 AK029475 mRNA Translation: BAC26466.1 AK076021 mRNA Translation: BAC36126.1 BC005713 mRNA Translation: AAH05713.1 BC021654 mRNA Translation: AAH21654.1
The Consensus CDS (CCDS) project More...CCDSⁱ	CCDS17457.1
PIRⁱ	JC5660
NCBI Reference Sequences More...RefSeqⁱ	NP_032257.3, NM_008231.4
UniGeneⁱ	Mm.292208

Genome annotation databases

Ensemblⁱ	ENSMUST00000005017; ENSMUSP00000005017; ENSMUSG00000004897
GeneIDⁱ	15191
KEGGⁱ	mmu:15191
UCSC genome browser More...UCSCⁱ	uc008ptc.2 mouse

Similar proteinsⁱ

100% Identity
90% Identity
50% Identity

Protein	Similar proteins		Species	Score	Length	Source
P51859	Hepatoma-derived growth factor (Fragment)		MOUSE		202	UniRef100_P51859
UPI00001F031F		MOUSE		205

Protein	Similar proteins		Species	Score	Length	Source
P51859	Hepatoma-derived growth factor (Fragment)		MOUSE		202	UniRef90_P51859
Hepatoma-derived growth factor		RAT		237
Uncharacterized protein		NEOLE		236
UPI00042AE51F		PERMB		238
UPI000A30ED75		MUSPA		237
+2

Protein	Similar proteins		Species	Score	Length	Source
P51859	Hepatoma-derived growth factor (Fragment)		MOUSE		202	UniRef50_P51859
Hepatoma-derived growth factor		RAT		237
Uncharacterized protein		NEOLE		236
Hepatoma-derived growth factor (Fragment)		NIPNI		140
Uncharacterized protein		ANOCA		221
+37

Cross-referencesⁱ

Sequence databases

Select the link destinations: EMBLⁱ GenBankⁱ DDBJⁱ Links Updated	D63707 mRNA Translation: BAA09838.1 AF251787 mRNA Translation: AAF65469.1 AK017863 mRNA Translation: BAB30979.1 AK029475 mRNA Translation: BAC26466.1 AK076021 mRNA Translation: BAC36126.1 BC005713 mRNA Translation: AAH05713.1 BC021654 mRNA Translation: AAH21654.1
CCDSⁱ	CCDS17457.1
PIRⁱ	JC5660
RefSeqⁱ	NP_032257.3, NM_008231.4
UniGeneⁱ	Mm.292208

3D structure databases

ProteinModelPortalⁱ	P51859
SMRⁱ	P51859
ModBaseⁱ	Search...
MobiDBⁱ	Search...

Protein-protein interaction databases

BioGridⁱ	200265, 2 interactors
IntActⁱ	P51859, 8 interactors
MINTⁱ	P51859
STRINGⁱ	10090.ENSMUSP00000005017

PTM databases

iPTMnetⁱ	P51859
PhosphoSitePlusⁱ	P51859
SwissPalmⁱ	P51859

Proteomic databases

EPDⁱ	P51859
MaxQBⁱ	P51859
PaxDbⁱ	P51859
PeptideAtlasⁱ	P51859
PRIDEⁱ	P51859
TopDownProteomicsⁱ	P51859

Protocols and materials databases

Structural Biology Knowledgebase	Search...

Structural Biology Knowledgebase

Search...

Genome annotation databases

Ensemblⁱ	ENSMUST00000005017; ENSMUSP00000005017; ENSMUSG00000004897
GeneIDⁱ	15191
KEGGⁱ	mmu:15191
UCSCⁱ	uc008ptc.2 mouse

Organism-specific databases

CTDⁱ	3068
MGIⁱ	MGI:1194494 Hdgf

Phylogenomic databases

eggNOGⁱ	ENOG410IMJ5 Eukaryota ENOG4111IFT LUCA
GeneTreeⁱ	ENSGT00530000063013
HOGENOMⁱ	HOG000112874
HOVERGENⁱ	HBG010574
InParanoidⁱ	P51859
KOⁱ	K16641
OrthoDBⁱ	EOG091G045X
PhylomeDBⁱ	P51859
TreeFamⁱ	TF105385

Miscellaneous databases

ChiTaRSⁱ	Hdgf mouse
PMAP-CutDBⁱ	P51859
Protein Ontology More...PROⁱ	PR:P51859
SOURCEⁱ	Search...

Gene expression databases

Bgeeⁱ	ENSMUSG00000004897 Expressed in 316 organ(s), highest expression level in ear vesicle
CleanExⁱ	MM_HDGF
ExpressionAtlasⁱ	P51859 baseline and differential
Genevisibleⁱ	P51859 MM

Family and domain databases

CDDⁱ	cd05834 HDGF_related, 1 hit
InterProⁱ	View protein in InterPro IPR035496 HDGF-rel_PWWP IPR000313 PWWP_dom
Pfamⁱ	View protein in Pfam PF00855 PWWP, 1 hit
SMARTⁱ	View protein in SMART SM00293 PWWP, 1 hit
PROSITEⁱ	View protein in PROSITE PS50812 PWWP, 1 hit
ProtoNetⁱ	Search...

Entry informationⁱ

Entry nameⁱ	HDGF_MOUSE
Accessionⁱ	P51859Primary (citable) accession number: P51859 Secondary accession number(s): Q8BPG7, Q9CYA4, Q9JK87
Entry historyⁱ	Integrated into UniProtKB/Swiss-Prot:	October 1, 1996
	Last sequence update:	August 13, 2002
	Last modified:	November 7, 2018
	This is version 156 of the entry and version 2 of the sequence. See complete history.
Entry statusⁱ	Reviewed (UniProtKB/Swiss-Prot)
Annotation program	Chordata Protein Annotation Program

Miscellaneousⁱ

Keywords - Technical termⁱ

Complete proteome, Reference proteome

Documents

SIMILARITY comments
Index of protein domains and families
MGD cross-references
Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot

UniProtKB

UniParc

Help

UniRef

Proteomes

Annotation systems

Supporting data

UniProtKB - P51859 (HDGF_MOUSE)

Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>

Hepatoma-derived growth factor

Hdgf

Select a section on the left to see content.

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Sites

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

Organism-specific databases

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Nucleus

Other locations

Extracellular region or secreted

Nucleus

Other locations

Keywords - Cellular componenti

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Amino acid modifications

Keywords - PTMi

Proteomic databases

PTM databases

Miscellaneous databases

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

GO - Molecular functioni

Protein-protein interaction databases

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Motif

Compositional bias

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Phylogenomic databases

Family and domain databases

Experimental Info

Sequence databases

Genome annotation databases

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

3D structure databases

Protein-protein interaction databases

PTM databases

Proteomic databases

Protocols and materials databases

Genome annotation databases

Organism-specific databases

Phylogenomic databases

Miscellaneous databases

Gene expression databases

Family and domain databases

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Documents

UniProt is an ELIXIR core data resource

Your basket is currently empty. ⁱ

Functionⁱ

GO - Molecular functionⁱ

GO - Biological processⁱ

Names & Taxonomyⁱ

Subcellular locationⁱ

Keywords - Cellular componentⁱ

PTM / Processingⁱ

Keywords - PTMⁱ

Expressionⁱ

Interactionⁱ

GO - Molecular functionⁱ

Structureⁱ

Family & Domainsⁱ

Sequence similaritiesⁱ

Cross-referencesⁱ

Entry informationⁱ

Miscellaneousⁱ

Keywords - Technical termⁱ