Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 174 (13 Feb 2019)
Sequence version 1 (01 Oct 1996)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Hepatoma-derived growth factor

Gene

HDGF

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Heparin-binding protein, with mitogenic activity for fibroblasts. Acts as a transcriptional repressor.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei19HeparinCurated1
Binding sitei21HeparinCurated1
Binding sitei72HeparinCurated1
Binding sitei75HeparinCurated1
Binding sitei79HeparinCurated1
Binding sitei80HeparinCurated1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • DNA binding Source: UniProtKB-KW
  • growth factor activity Source: UniProtKB-KW
  • heparin binding Source: ProtInc
  • nucleotide binding Source: UniProtKB-KW
  • RNA binding Source: UniProtKB
  • transcription corepressor activity Source: BHF-UCL
  • transcription corepressor binding Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Growth factor, Heparin-binding, Repressor
Biological processTranscription, Transcription regulation
LigandNucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-381038 XBP1(S) activates chaperone genes

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Hepatoma-derived growth factor
Short name:
HDGF
Alternative name(s):
High mobility group protein 1-like 2
Short name:
HMG-1L2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HDGF
Synonyms:HMG1L2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000143321.18

Human Gene Nomenclature Database

More...
HGNCi
HGNC:4856 HDGF

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
600339 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P51858

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
3068

Open Targets

More...
OpenTargetsi
ENSG00000143321

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA29234

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
HDGF

Domain mapping of disease mutations (DMDM)

More...
DMDMi
1708157

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001917001 – 240Hepatoma-derived growth factorAdd BLAST240

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei44N6-acetyllysineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki80Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO); alternate
Cross-linki80Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2); alternateCombined sources
Modified residuei132PhosphoserineCombined sources1
Modified residuei133PhosphoserineCombined sources1
Modified residuei165PhosphoserineCombined sources1
Modified residuei184PhosphothreonineCombined sources1
Modified residuei199PhosphoserineBy similarity1
Modified residuei200PhosphothreonineCombined sources1
Modified residuei202PhosphoserineCombined sources1
Modified residuei206PhosphoserineCombined sources1
Modified residuei239PhosphoserineCombined sources1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Sumoylated with SUMO1. Sumoylation prevents binding to chromatin.1 Publication

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P51858

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P51858

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P51858

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P51858

PeptideAtlas

More...
PeptideAtlasi
P51858

PRoteomics IDEntifications database

More...
PRIDEi
P51858

ProteomicsDB human proteome resource

More...
ProteomicsDBi
56439

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
P51858-1 [P51858-1]
P51858-2 [P51858-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P51858

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P51858

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P51858

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000143321 Expressed in 232 organ(s), highest expression level in endometrium epithelium

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P51858 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB026035
HPA048728
HPA053422

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Monomer, and domain-swapped homodimer.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
109318, 219 interactors

CORUM comprehensive resource of mammalian protein complexes

More...
CORUMi
P51858

Protein interaction database and analysis system

More...
IntActi
P51858, 116 interactors

Molecular INTeraction database

More...
MINTi
P51858

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000357189

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1240
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1RI0NMR-A1-100[»]
2NLUNMR-A/B1-100[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P51858

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P51858

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
P51858

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini12 – 69PWWPPROSITE-ProRule annotationAdd BLAST58

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi75 – 80Nuclear localization signal1 Publication6
Motifi155 – 170Bipartite nuclear localization signalAdd BLAST16

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi110 – 230Glu-richAdd BLAST121

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PWWP domain harbors the heparin-binding sites and is responsible for DNA-binding, while the C-terminal region is essentially unstructured.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the HDGF family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IMJ5 Eukaryota
ENOG4111IFT LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157485

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112874

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG010574

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P51858

KEGG Orthology (KO)

More...
KOi
K16641

Identification of Orthologs from Complete Genome Data

More...
OMAi
GEKKGNT

Database of Orthologous Groups

More...
OrthoDBi
530959at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P51858

TreeFam database of animal gene trees

More...
TreeFami
TF105385

Family and domain databases

Conserved Domains Database

More...
CDDi
cd05834 HDGF_related, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR035496 HDGF-rel_PWWP
IPR000313 PWWP_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00855 PWWP, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00293 PWWP, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50812 PWWP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P51858-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSRSNRQKEY KCGDLVFAKM KGYPHWPARI DEMPEAAVKS TANKYQVFFF
60 70 80 90 100
GTHETAFLGP KDLFPYEESK EKFGKPNKRK GFSEGLWEIE NNPTVKASGY
110 120 130 140 150
QSSQKKSCVE EPEPEPEAAE GDGDKKGNAE GSSDEEGKLV IDEPAKEKNE
160 170 180 190 200
KGALKRRAGD LLEDSPKRPK EAENPEGEEK EAATLEVERP LPMEVEKNST
210 220 230 240
PSEPGSGRGP PQEEEEEEDE EEEATKEDAE APGIRDHESL
Length:240
Mass (Da):26,788
Last modified:October 1, 1996 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDD60D9203BDD4B34
GO
Isoform 2 (identifier: P51858-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MSRSNRQKEYKCGDLVFAKMKGYPHWPAR → MEQRAGGNRVQTSTLNCAGAAV

Note: No experimental confirmation available.
Show »
Length:233
Mass (Da):25,538
Checksum:i629AFF8900895888
GO
Isoform 3 (identifier: P51858-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-29: MSRSNRQKEYKCGDLVFAKMKGYPHWPAR → MHPEGGQFVPQLLGHLLATKLKRFLLSKGGRRAQIPDVSRATPHT

Note: Gene prediction based on EST data.
Show »
Length:256
Mass (Da):28,264
Checksum:iD9D2BC3056553CF9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti206S → P in BAG53283 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_061209201P → L1 PublicationCorresponds to variant dbSNP:rs4399146Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0456201 – 29MSRSN…HWPAR → MEQRAGGNRVQTSTLNCAGA AV in isoform 2. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_0473281 – 29MSRSN…HWPAR → MHPEGGQFVPQLLGHLLATK LKRFLLSKGGRRAQIPDVSR ATPHT in isoform 3. CuratedAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
D16431 mRNA Translation: BAA03903.1
AK096411 mRNA Translation: BAG53283.1
AL590666 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52910.1
CH471121 Genomic DNA Translation: EAW52911.1
CH471121 Genomic DNA Translation: EAW52912.1
BC018991 mRNA Translation: AAH18991.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS1156.1 [P51858-1]
CCDS44247.1 [P51858-3]
CCDS44248.1 [P51858-2]

Protein sequence database of the Protein Information Resource

More...
PIRi
A55055

NCBI Reference Sequences

More...
RefSeqi
NP_001119522.1, NM_001126050.1 [P51858-3]
NP_001119523.1, NM_001126051.1 [P51858-2]
NP_001306115.1, NM_001319186.1
NP_001306116.1, NM_001319187.1
NP_001306117.1, NM_001319188.1
NP_004485.1, NM_004494.2 [P51858-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.743948

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000357325; ENSP00000349878; ENSG00000143321 [P51858-1]
ENST00000368206; ENSP00000357189; ENSG00000143321 [P51858-3]
ENST00000368209; ENSP00000357192; ENSG00000143321 [P51858-2]
ENST00000537739; ENSP00000443120; ENSG00000143321 [P51858-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
3068

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:3068

UCSC genome browser

More...
UCSCi
uc001fpy.5 human [P51858-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
D16431 mRNA Translation: BAA03903.1
AK096411 mRNA Translation: BAG53283.1
AL590666 Genomic DNA No translation available.
CH471121 Genomic DNA Translation: EAW52910.1
CH471121 Genomic DNA Translation: EAW52911.1
CH471121 Genomic DNA Translation: EAW52912.1
BC018991 mRNA Translation: AAH18991.1
CCDSiCCDS1156.1 [P51858-1]
CCDS44247.1 [P51858-3]
CCDS44248.1 [P51858-2]
PIRiA55055
RefSeqiNP_001119522.1, NM_001126050.1 [P51858-3]
NP_001119523.1, NM_001126051.1 [P51858-2]
NP_001306115.1, NM_001319186.1
NP_001306116.1, NM_001319187.1
NP_001306117.1, NM_001319188.1
NP_004485.1, NM_004494.2 [P51858-1]
UniGeneiHs.743948

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1RI0NMR-A1-100[»]
2NLUNMR-A/B1-100[»]
ProteinModelPortaliP51858
SMRiP51858
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi109318, 219 interactors
CORUMiP51858
IntActiP51858, 116 interactors
MINTiP51858
STRINGi9606.ENSP00000357189

PTM databases

iPTMnetiP51858
PhosphoSitePlusiP51858
SwissPalmiP51858

Polymorphism and mutation databases

BioMutaiHDGF
DMDMi1708157

Proteomic databases

EPDiP51858
jPOSTiP51858
MaxQBiP51858
PaxDbiP51858
PeptideAtlasiP51858
PRIDEiP51858
ProteomicsDBi56439
TopDownProteomicsiP51858-1 [P51858-1]
P51858-2 [P51858-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
3068
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000357325; ENSP00000349878; ENSG00000143321 [P51858-1]
ENST00000368206; ENSP00000357189; ENSG00000143321 [P51858-3]
ENST00000368209; ENSP00000357192; ENSG00000143321 [P51858-2]
ENST00000537739; ENSP00000443120; ENSG00000143321 [P51858-1]
GeneIDi3068
KEGGihsa:3068
UCSCiuc001fpy.5 human [P51858-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
3068
DisGeNETi3068
EuPathDBiHostDB:ENSG00000143321.18

GeneCards: human genes, protein and diseases

More...
GeneCardsi
HDGF
HGNCiHGNC:4856 HDGF
HPAiCAB026035
HPA048728
HPA053422
MIMi600339 gene
neXtProtiNX_P51858
OpenTargetsiENSG00000143321
PharmGKBiPA29234

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IMJ5 Eukaryota
ENOG4111IFT LUCA
GeneTreeiENSGT00940000157485
HOGENOMiHOG000112874
HOVERGENiHBG010574
InParanoidiP51858
KOiK16641
OMAiGEKKGNT
OrthoDBi530959at2759
PhylomeDBiP51858
TreeFamiTF105385

Enzyme and pathway databases

ReactomeiR-HSA-381038 XBP1(S) activates chaperone genes

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
HDGF human
EvolutionaryTraceiP51858

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
Hepatoma-derived_growth_factor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
3068

Protein Ontology

More...
PROi
PR:P51858

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000143321 Expressed in 232 organ(s), highest expression level in endometrium epithelium
GenevisibleiP51858 HS

Family and domain databases

CDDicd05834 HDGF_related, 1 hit
InterProiView protein in InterPro
IPR035496 HDGF-rel_PWWP
IPR000313 PWWP_dom
PfamiView protein in Pfam
PF00855 PWWP, 1 hit
SMARTiView protein in SMART
SM00293 PWWP, 1 hit
PROSITEiView protein in PROSITE
PS50812 PWWP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiHDGF_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P51858
Secondary accession number(s): B3KU21
, D3DVC9, Q5SZ07, Q5SZ08, Q5SZ09
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: October 1, 1996
Last modified: February 13, 2019
This is version 174 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again