Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 196 (18 Sep 2019)
Sequence version 2 (23 Jan 2002)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Zinc finger protein 41

Gene

ZNF41

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Caution

Although ZNF41 has been reported to be involved in X-linked mental retardation (PubMed:14628291), its pathological role is questionable (PubMed:23871722).2 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri313 – 335C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri341 – 364C2H2-type 2; degeneratePROSITE-ProRule annotationAdd BLAST24
Zinc fingeri369 – 391C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri397 – 419C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri425 – 447C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri453 – 475C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri481 – 503C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri509 – 531C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri537 – 559C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri565 – 587C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri593 – 615C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri621 – 643C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri649 – 671C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri677 – 699C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri705 – 727C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri733 – 755C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri761 – 783C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri789 – 811C2H2-type 18PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-212436 Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 41
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF41
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:13107 ZNF41

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
314995 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P51814

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

A chromosomal aberration involving ZNF41 has been found in a patient with severe mental retardation. Translocation t(X;7)(p11.3;q11.21).1 Publication

Organism-specific databases

DisGeNET

More...
DisGeNETi
7592

MalaCards human disease database

More...
MalaCardsi
ZNF41

Open Targets

More...
OpenTargetsi
ENSG00000147124

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...
Orphaneti
777 X-linked non-syndromic intellectual disability

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA37682

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF41

Domain mapping of disease mutations (DMDM)

More...
DMDMi
20141930

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000473741 – 821Zinc finger protein 41Add BLAST821

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki120Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki647Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P51814

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
P51814

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
P51814

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P51814

PeptideAtlas

More...
PeptideAtlasi
P51814

PRoteomics IDEntifications database

More...
PRIDEi
P51814

ProteomicsDB human proteome resource

More...
ProteomicsDBi
56410 [P51814-1]
56411 [P51814-2]
56412 [P51814-3]
56413 [P51814-4]
56414 [P51814-5]
56415 [P51814-6]
56416 [P51814-7]
56417 [P51814-8]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P51814

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P51814

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000147124 Expressed in 123 organ(s), highest expression level in muscle of leg

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P51814 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P51814 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA069102

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
113418, 4 interactors

Protein interaction database and analysis system

More...
IntActi
P51814, 7 interactors

Molecular INTeraction database

More...
MINTi
P51814

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000366265

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
P51814

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini69 – 140KRABPROSITE-ProRule annotationAdd BLAST72

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri313 – 335C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri341 – 364C2H2-type 2; degeneratePROSITE-ProRule annotationAdd BLAST24
Zinc fingeri369 – 391C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri397 – 419C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri425 – 447C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri453 – 475C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri481 – 503C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri509 – 531C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri537 – 559C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri565 – 587C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri593 – 615C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri621 – 643C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri649 – 671C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri677 – 699C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri705 – 727C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri733 – 755C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri761 – 783C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri789 – 811C2H2-type 18PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000163107

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P51814

KEGG Orthology (KO)

More...
KOi
K09228

Identification of Orthologs from Complete Genome Data

More...
OMAi
QCEKHLG

Database of Orthologous Groups

More...
OrthoDBi
172471at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P51814

TreeFam database of animal gene trees

More...
TreeFami
TF350810

Family and domain databases

Conserved Domains Database

More...
CDDi
cd07765 KRAB_A-box, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 17 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 17 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 10 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 17 hits
PS50157 ZINC_FINGER_C2H2_2, 18 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (8+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 8 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Note: Additional isoforms seem to exist.

This entry has 8 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: P51814-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAANGDSPPW SPALAAEGRG SSCEVRRERT PEARIHSVKR YPDLSPGPKG
60 70 80 90 100
RSSADHAALN SIVSLQASVS FEDVTVDFSK EEWQHLDPAQ RRLYWDVTLE
110 120 130 140 150
NYSHLLSVGY QIPKSEAAFK LEQGEGPWML EGEAPHQSCS GEAIGKMQQQ
160 170 180 190 200
GIPGGIFFHC ERFDQPIGED SLCSILEELW QDNDQLEQRQ ENQNNLLSHV
210 220 230 240 250
KVLIKERGYE HKNIEKIIHV TTKLVPSIKR LHNCDTILKH TLNSHNHNRN
260 270 280 290 300
SATKNLGKIF GNGNNFPHSP SSTKNENAKT GANSCEHDHY EKHLSHKQAP
310 320 330 340 350
THHQKIHPEE KLYVCTECVM GFTQKSHLFE HQRIHAGEKS RECDKSNKVF
360 370 380 390 400
PQKPQVDVHP SVYTGEKPYL CTQCGKVFTL KSNLITHQKI HTGQKPYKCS
410 420 430 440 450
ECGKAFFQRS DLFRHLRIHT GEKPYECSEC GKGFSQNSDL SIHQKTHTGE
460 470 480 490 500
KHYECNECGK AFTRKSALRM HQRIHTGEKP YVCADCGKAF IQKSHFNTHQ
510 520 530 540 550
RIHTGEKPYE CSDCGKSFTK KSQLHVHQRI HTGEKPYICT ECGKVFTHRT
560 570 580 590 600
NLTTHQKTHT GEKPYMCAEC GKAFTDQSNL IKHQKTHTGE KPYKCNGCGK
610 620 630 640 650
AFIWKSRLKI HQKSHIGERH YECKDCGKAF IQKSTLSVHQ RIHTGEKPYV
660 670 680 690 700
CPECGKAFIQ KSHFIAHHRI HTGEKPYECS DCGKCFTKKS QLRVHQKIHT
710 720 730 740 750
GEKPNICAEC GKAFTDRSNL ITHQKIHTRE KPYECGDCGK TFTWKSRLNI
760 770 780 790 800
HQKSHTGERH YECSKCGKAF IQKATLSMHQ IIHTGKKPYA CTECQKAFTD
810 820
RSNLIKHQKM HSGEKRYKAS D
Length:821
Mass (Da):93,728
Last modified:January 23, 2002 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF44B7808C9A8AF13
GO
Isoform 2 (identifier: P51814-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAANGDSPPW...RSSADHAALN → MGTLPHGPRPWLQRDVAAHV

Show »
Length:781
Mass (Da):89,598
Checksum:iB0531CFE87C20260
GO
Isoform 3 (identifier: P51814-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MAANGDSPPWSPALAAEGRGSSCEVRRERTPEARIHSVKRYPDLSPGPKGRS → MGTLPHGPRPWLQRDVAAHV

Show »
Length:789
Mass (Da):90,377
Checksum:i076E49C3D94E3255
GO
Isoform 4 (identifier: P51814-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-128: Missing.

Show »
Length:693
Mass (Da):79,538
Checksum:iD41671F68B91656B
GO
Isoform 5 (identifier: P51814-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-60: Missing.

Show »
Length:813
Mass (Da):92,948
Checksum:i14FF48F2EADA1687
GO
Isoform 6 (identifier: P51814-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-66: Missing.

Show »
Length:779
Mass (Da):89,093
Checksum:iB0EF06F2B69F97F1
GO
Isoform 7 (identifier: P51814-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-60: MAANGDSPPW...RSSADHAALN → MGTLPHGPRPWLQRDVAAHV
     141-176: Missing.

Show »
Length:745
Mass (Da):85,693
Checksum:i3A0B309355565CA4
GO
Isoform 8 (identifier: P51814-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-66: Missing.
     141-176: Missing.

Show »
Length:743
Mass (Da):85,188
Checksum:i0BC6B01F1914D57E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B1AQ29B1AQ29_HUMAN
Zinc finger protein 41
ZNF41
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti111Q → R in CAB53039 (PubMed:10449920).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_021785153P → L Rare variant found in patients with X-linked mental retardation; unknown pathological significance. 1 PublicationCorresponds to variant dbSNP:rs104894955Ensembl.1
Natural variantiVAR_021786167I → R1 PublicationCorresponds to variant dbSNP:rs17147624Ensembl.1
Natural variantiVAR_021787357D → E1 PublicationCorresponds to variant dbSNP:rs2498170Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0068871 – 128Missing in isoform 4. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_0068831 – 60MAANG…HAALN → MGTLPHGPRPWLQRDVAAHV in isoform 7 and isoform 2. CuratedAdd BLAST60
Alternative sequenceiVSP_0068841 – 52MAANG…PKGRS → MGTLPHGPRPWLQRDVAAHV in isoform 3. CuratedAdd BLAST52
Alternative sequenceiVSP_00688525 – 66Missing in isoform 6 and isoform 8. 2 PublicationsAdd BLAST42
Alternative sequenceiVSP_00688653 – 60Missing in isoform 5. Curated8
Alternative sequenceiVSP_006888141 – 176Missing in isoform 7 and isoform 8. CuratedAdd BLAST36

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X60155 mRNA Translation: CAB51740.1
AJ010017 mRNA Translation: CAB53035.1
AJ010018 mRNA Translation: CAB53036.1
AJ010019 mRNA Translation: CAB53037.1
AJ010020 mRNA Translation: CAB53038.1
AJ010021 mRNA Translation: CAB53039.1
AJ010022 mRNA Translation: CAB53040.1
AJ010023 mRNA Translation: CAB53041.1
AK290021 mRNA Translation: BAF82710.1
AK294858 mRNA Translation: BAG57962.1
AL590223 Genomic DNA No translation available.
AL590283 Genomic DNA No translation available.
CH471164 Genomic DNA Translation: EAW59303.1
BC015023 mRNA Translation: AAH15023.1
M92443 Genomic DNA Translation: AAA61312.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS14279.1 [P51814-6]

Protein sequence database of the Protein Information Resource

More...
PIRi
A54661

NCBI Reference Sequences

More...
RefSeqi
NP_001311068.1, NM_001324139.1 [P51814-4]
NP_001311069.1, NM_001324140.1 [P51814-6]
NP_001311070.1, NM_001324141.1 [P51814-4]
NP_001311071.1, NM_001324142.1 [P51814-2]
NP_001311072.1, NM_001324143.1 [P51814-4]
NP_001311073.1, NM_001324144.1 [P51814-6]
NP_001311074.1, NM_001324145.1 [P51814-4]
NP_001311076.1, NM_001324147.1 [P51814-6]
NP_001311077.1, NM_001324148.1 [P51814-2]
NP_001311078.1, NM_001324149.1 [P51814-4]
NP_001311079.1, NM_001324150.1 [P51814-6]
NP_001311080.1, NM_001324151.1 [P51814-3]
NP_001311081.1, NM_001324152.1 [P51814-4]
NP_001311082.1, NM_001324153.1 [P51814-3]
NP_001311083.1, NM_001324154.1 [P51814-5]
NP_001311084.1, NM_001324155.1 [P51814-1]
NP_001311085.1, NM_001324156.1 [P51814-7]
NP_001311086.1, NM_001324157.1 [P51814-8]
NP_009061.1, NM_007130.3 [P51814-6]
NP_700359.1, NM_153380.3 [P51814-6]
XP_006724613.1, XM_006724550.3 [P51814-5]
XP_006724618.1, XM_006724555.3 [P51814-3]
XP_016885299.1, XM_017029810.1 [P51814-5]
XP_016885300.1, XM_017029811.1 [P51814-5]
XP_016885301.1, XM_017029812.1 [P51814-5]
XP_016885302.1, XM_017029813.1 [P51814-5]
XP_016885303.1, XM_017029814.1 [P51814-5]
XP_016885304.1, XM_017029815.1 [P51814-5]
XP_016885305.1, XM_017029816.1 [P51814-3]
XP_016885306.1, XM_017029817.1 [P51814-6]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000313116; ENSP00000315173; ENSG00000147124 [P51814-6]
ENST00000377065; ENSP00000366265; ENSG00000147124 [P51814-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
7592

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:7592

UCSC genome browser

More...
UCSCi
uc004dhx.5 human [P51814-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X60155 mRNA Translation: CAB51740.1
AJ010017 mRNA Translation: CAB53035.1
AJ010018 mRNA Translation: CAB53036.1
AJ010019 mRNA Translation: CAB53037.1
AJ010020 mRNA Translation: CAB53038.1
AJ010021 mRNA Translation: CAB53039.1
AJ010022 mRNA Translation: CAB53040.1
AJ010023 mRNA Translation: CAB53041.1
AK290021 mRNA Translation: BAF82710.1
AK294858 mRNA Translation: BAG57962.1
AL590223 Genomic DNA No translation available.
AL590283 Genomic DNA No translation available.
CH471164 Genomic DNA Translation: EAW59303.1
BC015023 mRNA Translation: AAH15023.1
M92443 Genomic DNA Translation: AAA61312.1
CCDSiCCDS14279.1 [P51814-6]
PIRiA54661
RefSeqiNP_001311068.1, NM_001324139.1 [P51814-4]
NP_001311069.1, NM_001324140.1 [P51814-6]
NP_001311070.1, NM_001324141.1 [P51814-4]
NP_001311071.1, NM_001324142.1 [P51814-2]
NP_001311072.1, NM_001324143.1 [P51814-4]
NP_001311073.1, NM_001324144.1 [P51814-6]
NP_001311074.1, NM_001324145.1 [P51814-4]
NP_001311076.1, NM_001324147.1 [P51814-6]
NP_001311077.1, NM_001324148.1 [P51814-2]
NP_001311078.1, NM_001324149.1 [P51814-4]
NP_001311079.1, NM_001324150.1 [P51814-6]
NP_001311080.1, NM_001324151.1 [P51814-3]
NP_001311081.1, NM_001324152.1 [P51814-4]
NP_001311082.1, NM_001324153.1 [P51814-3]
NP_001311083.1, NM_001324154.1 [P51814-5]
NP_001311084.1, NM_001324155.1 [P51814-1]
NP_001311085.1, NM_001324156.1 [P51814-7]
NP_001311086.1, NM_001324157.1 [P51814-8]
NP_009061.1, NM_007130.3 [P51814-6]
NP_700359.1, NM_153380.3 [P51814-6]
XP_006724613.1, XM_006724550.3 [P51814-5]
XP_006724618.1, XM_006724555.3 [P51814-3]
XP_016885299.1, XM_017029810.1 [P51814-5]
XP_016885300.1, XM_017029811.1 [P51814-5]
XP_016885301.1, XM_017029812.1 [P51814-5]
XP_016885302.1, XM_017029813.1 [P51814-5]
XP_016885303.1, XM_017029814.1 [P51814-5]
XP_016885304.1, XM_017029815.1 [P51814-5]
XP_016885305.1, XM_017029816.1 [P51814-3]
XP_016885306.1, XM_017029817.1 [P51814-6]

3D structure databases

SMRiP51814
ModBaseiSearch...

Protein-protein interaction databases

BioGridi113418, 4 interactors
IntActiP51814, 7 interactors
MINTiP51814
STRINGi9606.ENSP00000366265

PTM databases

iPTMnetiP51814
PhosphoSitePlusiP51814

Polymorphism and mutation databases

BioMutaiZNF41
DMDMi20141930

Proteomic databases

EPDiP51814
jPOSTiP51814
MassIVEiP51814
MaxQBiP51814
PeptideAtlasiP51814
PRIDEiP51814
ProteomicsDBi56410 [P51814-1]
56411 [P51814-2]
56412 [P51814-3]
56413 [P51814-4]
56414 [P51814-5]
56415 [P51814-6]
56416 [P51814-7]
56417 [P51814-8]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...
ABCDi
P51814

The DNASU plasmid repository

More...
DNASUi
7592
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000313116; ENSP00000315173; ENSG00000147124 [P51814-6]
ENST00000377065; ENSP00000366265; ENSG00000147124 [P51814-6]
GeneIDi7592
KEGGihsa:7592
UCSCiuc004dhx.5 human [P51814-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
7592
DisGeNETi7592

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF41
HGNCiHGNC:13107 ZNF41
HPAiHPA069102
MalaCardsiZNF41
MIMi314995 gene
neXtProtiNX_P51814
OpenTargetsiENSG00000147124
Orphaneti777 X-linked non-syndromic intellectual disability
PharmGKBiPA37682

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000163107
InParanoidiP51814
KOiK09228
OMAiQCEKHLG
OrthoDBi172471at2759
PhylomeDBiP51814
TreeFamiTF350810

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ZNF41 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
ZNF41

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
7592

Pharos

More...
Pharosi
P51814

Protein Ontology

More...
PROi
PR:P51814

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000147124 Expressed in 123 organ(s), highest expression level in muscle of leg
ExpressionAtlasiP51814 baseline and differential
GenevisibleiP51814 HS

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
PF00096 zf-C2H2, 17 hits
SMARTiView protein in SMART
SM00349 KRAB, 1 hit
SM00355 ZnF_C2H2, 17 hits
SUPFAMiSSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 10 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 17 hits
PS50157 ZINC_FINGER_C2H2_2, 18 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZNF41_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P51814
Secondary accession number(s): A8K1V6
, B4DH01, Q96LE8, Q9UMC4, Q9UMV5, Q9UMV6, Q9UMV7, Q9UMV8, Q9UMV9, Q9UMW0, Q9UMW1
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 23, 2002
Last modified: September 18, 2019
This is version 196 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again