Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Chloride transport protein 6

Gene

CLCN6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Chloride transport protein, initially identified as voltage-gated chloride channel. The presence of the conserved gating glutamate residues suggests that is functions as antiporter.

Miscellaneous

The CLC channel family contains both chloride channels and proton-coupled anion transporters that exchange chloride or another anion for protons. The presence of conserved gating glutamate residues is typical for family members that function as antiporters (By similarity).By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei157ChlorideBy similarity1
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei200Mediates proton transfer from the outer aqueous phase to the interior of the protein; involved in linking H(+) and Cl(-) transportBy similarity1
Sitei267Mediates proton transfer from the protein to the inner aqueous phaseBy similarity1
Binding sitei489Chloride; via amide nitrogenBy similarity1
Binding sitei576ChlorideBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi630 – 632ATPBy similarity3
Nucleotide bindingi849 – 852ATPBy similarity4

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • antiporter activity Source: Reactome
  • ATP binding Source: UniProtKB-KW
  • voltage-gated chloride channel activity Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processAntiport, Ion transport, Transport
LigandATP-binding, Chloride, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-2672351 Stimuli-sensing channels
R-HSA-6802952 Signaling by BRAF and RAF fusions

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Chloride transport protein 6
Alternative name(s):
Chloride channel protein 6
Short name:
ClC-6
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CLCN6
Synonyms:KIAA0046
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000011021.21

Human Gene Nomenclature Database

More...
HGNCi
HGNC:2024 CLCN6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
602726 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_P51797

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 80CytoplasmicBy similarityAdd BLAST80
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei81 – 113HelicalBy similarityAdd BLAST33
Transmembranei128 – 150HelicalBy similarityAdd BLAST23
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a region that is buried within a membrane, but does not cross it.<p><a href='/help/intramem' target='_top'>More...</a></p>Intramembranei159 – 166HelicalBy similarity8
Transmembranei176 – 194HelicalBy similarityAdd BLAST19
Transmembranei200 – 217HelicalBy similarityAdd BLAST18
Intramembranei241 – 253HelicalBy similarityAdd BLAST13
Intramembranei257 – 265HelicalBy similarity9
Transmembranei277 – 294HelicalBy similarityAdd BLAST18
Transmembranei335 – 364HelicalBy similarityAdd BLAST30
Transmembranei371 – 392HelicalBy similarityAdd BLAST22
Transmembranei462 – 481HelicalBy similarityAdd BLAST20
Transmembranei487 – 511HelicalBy similarityAdd BLAST25
Intramembranei519 – 533HelicalBy similarityAdd BLAST15
Intramembranei534 – 536Note=Loop between two helicesBy similarity3
Intramembranei537 – 548HelicalBy similarityAdd BLAST12
Intramembranei549 – 552Note=Loop between two helicesBy similarity4
Transmembranei553 – 571HelicalBy similarityAdd BLAST19
Topological domaini572 – 869CytoplasmicBy similarityAdd BLAST298

Keywords - Cellular componenti

Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi410N → A: Abolishes N-glycosylation; when associated with A-422 and A-432. 1 Publication1
Mutagenesisi422N → A: Abolishes N-glycosylation; when associated with A-410 and A-432. 1 Publication1
Mutagenesisi432N → A: Abolishes N-glycosylation; when associated with A-410 and A-422. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
1185

Open Targets

More...
OpenTargetsi
ENSG00000011021

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA26551

Chemistry databases

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
705

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CLCN6

Domain mapping of disease mutations (DMDM)

More...
DMDMi
311033364

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000944491 – 869Chloride transport protein 6Add BLAST869

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi410N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi422N-linked (GlcNAc...) asparagine1 Publication1
Glycosylationi432N-linked (GlcNAc...) asparagine1 Publication1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei773PhosphoserineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

N-glycosylated on several asparagine residues.1 Publication

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
P51797

MaxQB - The MaxQuant DataBase

More...
MaxQBi
P51797

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
P51797

PeptideAtlas

More...
PeptideAtlasi
P51797

PRoteomics IDEntifications database

More...
PRIDEi
P51797

ProteomicsDB human proteome resource

More...
ProteomicsDBi
56393
56394 [P51797-2]
56395 [P51797-3]
56396 [P51797-4]
56397 [P51797-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
P51797

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
P51797

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
P51797

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Testis, ovary, small intestine, brain and skeletal muscle. Low level expression in aortic and coronary vascular smooth muscle cells, and aortic endothelial cells. Isoform 3 is only detected in kidney.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000011021 Expressed in 184 organ(s), highest expression level in left lobe of thyroid gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
P51797 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
P51797 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA032097

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
107599, 5 interactors

Protein interaction database and analysis system

More...
IntActi
P51797, 1 interactor

Molecular INTeraction database

More...
MINTi
P51797

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000234488

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
P51797

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini605 – 662CBS 1PROSITE-ProRule annotationAdd BLAST58
Domaini807 – 868CBS 2PROSITE-ProRule annotationAdd BLAST62

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi156 – 160Selectivity filter part_1By similarity5
Motifi198 – 202Selectivity filter part_2By similarity5
Motifi487 – 491Selectivity filter part_3By similarity5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi4 – 18Cys-richAdd BLAST15

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

CBS domain, Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0474 Eukaryota
COG0038 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159291

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050985

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
P51797

KEGG Orthology (KO)

More...
KOi
K05015

Identification of Orthologs from Complete Genome Data

More...
OMAi
EMTEDYP

Database of Orthologous Groups

More...
OrthoDBi
EOG091G01HL

Database for complete collections of gene phylogenies

More...
PhylomeDBi
P51797

TreeFam database of animal gene trees

More...
TreeFami
TF313867

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR000644 CBS_dom
IPR014743 Cl-channel_core
IPR001807 Cl-channel_volt-gated
IPR002248 Cl_channel-6

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00571 CBS, 2 hits
PF00654 Voltage_CLC, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00762 CLCHANNEL
PR01117 CLCHANNEL6

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00116 CBS, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF81340 SSF81340, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51371 CBS, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: P51797-1) [UniParc]FASTAAdd to basket
Also known as: A, Clc-6a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGCRGSLCC CCRWCCCCGE RETRTPEELT ILGETQEEED EILPRKDYES
60 70 80 90 100
LDYDRCINDP YLEVLETMDN KKGRRYEAVK WMVVFAIGVC TGLVGLFVDF
110 120 130 140 150
FVRLFTQLKF GVVQTSVEEC SQKGCLALSL LELLGFNLTF VFLASLLVLI
160 170 180 190 200
EPVAAGSGIP EVKCYLNGVK VPGIVRLRTL LCKVLGVLFS VAGGLFVEKE
210 220 230 240 250
GPMIHSGSVV GAGLPQFQSI SLRKIQFNFP YFRSDRDKRD FVSAGAAAGV
260 270 280 290 300
AAAFGAPIGG TLFSLEEGSS FWNQGLTWKV LFCSMSATFT LNFFRSGIQF
310 320 330 340 350
GSWGSFQLPG LLNFGEFKCS DSDKKCHLWT AMDLGFFVVM GVIGGLLGAT
360 370 380 390 400
FNCLNKRLAK YRMRNVHPKP KLVRVLESLL VSLVTTVVVF VASMVLGECR
410 420 430 440 450
QMSSSSQIGN DSFQLQVTED VNSSIKTFFC PNDTYNDMAT LFFNPQESAI
460 470 480 490 500
LQLFHQDGTF SPVTLALFFV LYFLLACWTY GISVPSGLFV PSLLCGAAFG
510 520 530 540 550
RLVANVLKSY IGLGHIYSGT FALIGAAAFL GGVVRMTISL TVILIESTNE
560 570 580 590 600
ITYGLPIMVT LMVAKWTGDF FNKGIYDIHV GLRGVPLLEW ETEVEMDKLR
610 620 630 640 650
ASDIMEPNLT YVYPHTRIQS LVSILRTTVH HAFPVVTENR GNEKEFMKGN
660 670 680 690 700
QLISNNIKFK KSSILTRAGE QRKRSQSMKS YPSSELRNMC DEHIASEEPA
710 720 730 740 750
EKEDLLQQML ERRYTPYPNL YPDQSPSEDW TMEERFRPLT FHGLILRSQL
760 770 780 790 800
VTLLVRGVCY SESQSSASQP RLSYAEMAED YPRYPDIHDL DLTLLNPRMI
810 820 830 840 850
VDVTPYMNPS PFTVSPNTHV SQVFNLFRTM GLRHLPVVNA VGEIVGIITR
860
HNLTYEFLQA RLRQHYQTI
Length:869
Mass (Da):97,289
Last modified:November 2, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD625F0C2189EB6F7
GO
Isoform 2 (identifier: P51797-2) [UniParc]FASTAAdd to basket
Also known as: B, ClC-6b, D2-A1

The sequence of this isoform differs from the canonical sequence as follows:
     237-320: DKRDFVSAGA...LLNFGEFKCS → YGKRQERLCI...APWIAELWRV
     321-869: Missing.

Show »
Length:320
Mass (Da):36,006
Checksum:i68604EBB1B15E8CA
GO
Isoform 3 (identifier: P51797-3) [UniParc]FASTAAdd to basket
Also known as: C, ClC-6c, D1-A1

The sequence of this isoform differs from the canonical sequence as follows:
     319-353: CSDSDKKCHLWTAMDLGFFVVMGVIGGLLGATFNC → SLREPPCVSGNHRGGVCGLDGVRRMPTDVLFESNR
     354-869: Missing.

Show »
Length:353
Mass (Da):38,814
Checksum:i078D3E8A2C013E94
GO
Isoform 4 (identifier: P51797-4) [UniParc]FASTAAdd to basket
Also known as: D, ClC-6d, D1-A2

The sequence of this isoform differs from the canonical sequence as follows:
     237-308: DKRDFVSAGA...QFGSWGSFQL → SGCWSCCSFR...APWIAELWRV
     309-869: Missing.

Show »
Length:308
Mass (Da):34,515
Checksum:i60C3293CAC95D6BE
GO
Isoform 5 (identifier: P51797-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     844-869: IVGIITRHNLTYEFLQARLRQHYQTI → VSEAPALPPP...LHLRRDLRIR

Note: No experimental confirmation available.
Show »
Length:953
Mass (Da):106,376
Checksum:i5503065172532131
GO
Isoform 6 (identifier: P51797-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     50-71: Missing.

Note: No experimental confirmation available.
Show »
Length:847
Mass (Da):94,660
Checksum:i00E66C8453C4B6F6
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti19G → S in BAG57898 (PubMed:14702039).Curated1
Sequence conflicti92G → D in BAG57898 (PubMed:14702039).Curated1
Sequence conflicti442F → S in BAG57898 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_023051198E → G7 PublicationsCorresponds to variant dbSNP:rs198400Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04716950 – 71Missing in isoform 6. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_001043237 – 320DKRDF…EFKCS → YGKRQERLCISRSGCWSCCS FRGANRGYLVQSRGGFVLLE PRAHVESALLFHVCHLHPQL LPFWDSVWKLGFLPAPWIAE LWRV in isoform 2. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_001047237 – 308DKRDF…GSFQL → SGCWSCCSFRGANRGYLVQS RGGFVLLEPRAHVESALLFH VCHLHPQLLPFWDSVWKLGF LPAPWIAELWRV in isoform 4. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_001048309 – 869Missing in isoform 4. 1 PublicationAdd BLAST561
Alternative sequenceiVSP_001045319 – 353CSDSD…ATFNC → SLREPPCVSGNHRGGVCGLD GVRRMPTDVLFESNR in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_001044321 – 869Missing in isoform 2. 1 PublicationAdd BLAST549
Alternative sequenceiVSP_001046354 – 869Missing in isoform 3. 1 PublicationAdd BLAST516
Alternative sequenceiVSP_017188844 – 869IVGII…HYQTI → VSEAPALPPPLREDPLARCC LCTQASHQKRRHPTRRGECG PTLALNPARLPCTRDPFPCL PADGTSVPLAVLSSQSRAST RLCLPPEMLLFTPYHWCSLV LHLRRDLRIR in isoform 5. CuratedAdd BLAST26

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
X83378 mRNA Translation: CAA58292.1
X96391 mRNA Translation: CAA65255.1
X99472 Genomic DNA Translation: CAA67835.1
X99473 mRNA Translation: CAA67836.1
X99474 mRNA Translation: CAA67837.1
X99475 mRNA Translation: CAA67838.1
AF009257
, AF009247, AF009248, AF009249, AF009250, AF009251, AF009252, AF009253, AF009254, AF009255, AF009256 Genomic DNA Translation: AAB69287.1
D28475 mRNA Translation: BAA05836.4
AK289999 mRNA Translation: BAF82688.1
AK294764 mRNA Translation: BAG57898.1
AL021155 Genomic DNA No translation available.
AL953897 Genomic DNA No translation available.
CH471130 Genomic DNA Translation: EAW71715.1
BC117420 mRNA Translation: AAI17421.1
BC117424 mRNA Translation: AAI17425.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS138.1 [P51797-1]
CCDS57972.1 [P51797-6]

Protein sequence database of the Protein Information Resource

More...
PIRi
S68428

NCBI Reference Sequences

More...
RefSeqi
NP_001243888.1, NM_001256959.1
NP_001277.1, NM_001286.3

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.193043

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000312413; ENSP00000308367; ENSG00000011021 [P51797-6]
ENST00000346436; ENSP00000234488; ENSG00000011021 [P51797-1]
ENST00000376496; ENSP00000365679; ENSG00000011021 [P51797-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
1185

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:1185

UCSC genome browser

More...
UCSCi
uc001ate.6 human [P51797-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
X83378 mRNA Translation: CAA58292.1
X96391 mRNA Translation: CAA65255.1
X99472 Genomic DNA Translation: CAA67835.1
X99473 mRNA Translation: CAA67836.1
X99474 mRNA Translation: CAA67837.1
X99475 mRNA Translation: CAA67838.1
AF009257
, AF009247, AF009248, AF009249, AF009250, AF009251, AF009252, AF009253, AF009254, AF009255, AF009256 Genomic DNA Translation: AAB69287.1
D28475 mRNA Translation: BAA05836.4
AK289999 mRNA Translation: BAF82688.1
AK294764 mRNA Translation: BAG57898.1
AL021155 Genomic DNA No translation available.
AL953897 Genomic DNA No translation available.
CH471130 Genomic DNA Translation: EAW71715.1
BC117420 mRNA Translation: AAI17421.1
BC117424 mRNA Translation: AAI17425.1
CCDSiCCDS138.1 [P51797-1]
CCDS57972.1 [P51797-6]
PIRiS68428
RefSeqiNP_001243888.1, NM_001256959.1
NP_001277.1, NM_001286.3
UniGeneiHs.193043

3D structure databases

ProteinModelPortaliP51797
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi107599, 5 interactors
IntActiP51797, 1 interactor
MINTiP51797
STRINGi9606.ENSP00000234488

Chemistry databases

GuidetoPHARMACOLOGYi705

PTM databases

iPTMnetiP51797
PhosphoSitePlusiP51797
SwissPalmiP51797

Polymorphism and mutation databases

BioMutaiCLCN6
DMDMi311033364

Proteomic databases

EPDiP51797
MaxQBiP51797
PaxDbiP51797
PeptideAtlasiP51797
PRIDEiP51797
ProteomicsDBi56393
56394 [P51797-2]
56395 [P51797-3]
56396 [P51797-4]
56397 [P51797-5]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
1185
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000312413; ENSP00000308367; ENSG00000011021 [P51797-6]
ENST00000346436; ENSP00000234488; ENSG00000011021 [P51797-1]
ENST00000376496; ENSP00000365679; ENSG00000011021 [P51797-5]
GeneIDi1185
KEGGihsa:1185
UCSCiuc001ate.6 human [P51797-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1185
DisGeNETi1185
EuPathDBiHostDB:ENSG00000011021.21

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CLCN6
HGNCiHGNC:2024 CLCN6
HPAiHPA032097
MIMi602726 gene
neXtProtiNX_P51797
OpenTargetsiENSG00000011021
PharmGKBiPA26551

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0474 Eukaryota
COG0038 LUCA
GeneTreeiENSGT00940000159291
HOVERGENiHBG050985
InParanoidiP51797
KOiK05015
OMAiEMTEDYP
OrthoDBiEOG091G01HL
PhylomeDBiP51797
TreeFamiTF313867

Enzyme and pathway databases

ReactomeiR-HSA-2672351 Stimuli-sensing channels
R-HSA-6802952 Signaling by BRAF and RAF fusions

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CLCN6 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
CLCN6

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
1185

Protein Ontology

More...
PROi
PR:P51797

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000011021 Expressed in 184 organ(s), highest expression level in left lobe of thyroid gland
ExpressionAtlasiP51797 baseline and differential
GenevisibleiP51797 HS

Family and domain databases

InterProiView protein in InterPro
IPR000644 CBS_dom
IPR014743 Cl-channel_core
IPR001807 Cl-channel_volt-gated
IPR002248 Cl_channel-6
PfamiView protein in Pfam
PF00571 CBS, 2 hits
PF00654 Voltage_CLC, 1 hit
PRINTSiPR00762 CLCHANNEL
PR01117 CLCHANNEL6
SMARTiView protein in SMART
SM00116 CBS, 2 hits
SUPFAMiSSF81340 SSF81340, 1 hit
PROSITEiView protein in PROSITE
PS51371 CBS, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCLCN6_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P51797
Secondary accession number(s): A8K1T4
, B4DGT7, F8W9R3, O60818, O60819, O60820, O60821, P78520, P78521, Q17R81, Q5SNW2, Q5SNW3, Q5SNX1, Q5SNX2, Q5SNX3, Q99427, Q99428, Q99429
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: November 2, 2010
Last modified: December 5, 2018
This is version 174 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again