Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - P51572 (BAP31_HUMAN)

Protein

B-cell receptor-associated protein 31

Gene

BCAP31

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functions as a chaperone protein. Is one of the most abundant endoplasmic reticulum (ER) proteins. Plays a role in the export of secreted proteins in the ER, the recognition of abnormally folded protein and their targeting to the ER associated-degradation (ERAD). Also serves as a cargo receptor for the export of transmembrane proteins. May be involved in CASP8-mediated apoptosis.3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis, ER-Golgi transport, Protein transport, Transport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-111465 Apoptotic cleavage of cellular proteins
R-HSA-75153 Apoptotic execution phase
R-HSA-983170 Antigen Presentation: Folding, assembly and peptide loading of class I MHC

Protein family/group databases

Transport Classification Database

More...TCDBi		3.A.5.9.1 the general secretory pathway (sec) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
B-cell receptor-associated protein 31
Short name:
BCR-associated protein 31
Short name:
Bap31
Alternative name(s):
6C6-AG tumor-associated antigen
Protein CDM
p28
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:BCAP31
Synonyms:BAP31, DXS1357E
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome X

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000185825.15

Human Gene Nomenclature Database

More...HGNCi		HGNC:16695 BCAP31

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		300398 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_P51572

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini2 – 6LumenalSequence analysis5
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei7 – 27HelicalSequence analysisAdd BLAST21
Topological domaini28 – 43CytoplasmicSequence analysisAdd BLAST16
Transmembranei44 – 64HelicalSequence analysisAdd BLAST21
Topological domaini65 – 102LumenalSequence analysisAdd BLAST38
Transmembranei103 – 123HelicalSequence analysisAdd BLAST21
Topological domaini124 – 246CytoplasmicSequence analysisAdd BLAST123

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Deafness, dystonia, and cerebral hypomyelination (DDCH)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionAn X-linked recessive mental retardation syndrome characterized by almost no psychomotor development, dysmorphic facial features, sensorineural deafness, dystonia, pyramidal signs, and hypomyelination on brain imaging.
See also OMIM:300475
BCAP31 is deleted in the chromosome Xq28 deletion syndrome which involves BCAP31 and the and the promoter region of ABCD1.1 Publication

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi164D → A: Abolishes cleavage by caspases, inhibits apoptotic membrane blebbing and release of cytochrome c from mitochondria; when associated with A-238. 1 Publication1
Mutagenesisi238D → A: Abolishes cleavage by caspases, inhibits apoptotic membrane blebbing and release of cytochrome c from mitochondria; when associated with A-164. 1 Publication1

Keywords - Diseasei

Deafness, Dystonia, Mental retardation

Organism-specific databases

DisGeNET

More...DisGeNETi		10134

MalaCards human disease database

More...MalaCardsi		BCAP31
MIMi300475 phenotype

Open Targets

More...OpenTargetsi		ENSG00000185825

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		369942 CADDS
369939 Severe motor and intellectual disabilities-sensorineural deafness-dystonia syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA128394569

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		BCAP31

Domain mapping of disease mutations (DMDM)

More...DMDMi		1705725

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved1 Publication
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001428912 – 246B-cell receptor-associated protein 31Add BLAST245

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Cleaved by CASP8 and other caspases.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection describes interesting single amino acid sites on the sequence that are not defined in any other subsection. This subsection can be displayed in different sections (‘Function’, ‘PTM / Processing’, ‘Pathology and Biotech’) according to its content.<p><a href='/help/site' target='_top'>More...</a></p>Sitei164 – 165Cleavage; by caspase-8Sequence analysis2
Sitei238 – 239Cleavage; by caspase-8Sequence analysis2

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		P51572

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		P51572

MaxQB - The MaxQuant DataBase

More...MaxQBi		P51572

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		P51572

PeptideAtlas

More...PeptideAtlasi		P51572

PRoteomics IDEntifications database

More...PRIDEi		P51572

ProteomicsDB human proteome resource

More...ProteomicsDBi		56335
56336 [P51572-2]

Consortium for Top Down Proteomics

More...TopDownProteomicsi		P51572-1 [P51572-1]
P51572-2 [P51572-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		P51572

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		P51572

SwissPalm database of S-palmitoylation events

More...SwissPalmi		P51572

Miscellaneous databases

CutDB - Proteolytic event database

More...PMAP-CutDBi		P51572

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitous. Highly expressed in neurons and discrete endocrine cells.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000185825 Expressed in 230 organ(s), highest expression level in subcutaneous adipose tissue

CleanEx database of gene expression profiles

More...CleanExi		HS_BCAP31

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		P51572 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		P51572 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		CAB015350
CAB015424
HPA003906

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer and heterodimer with BCAP29. Binds CASP8 (isoform 9) as a complex containing BCAP31, BCAP29, BCL2 and/or BCL2L1. Interacts with VAMP3, VAMP1 and membrane IgD immunoglobulins. May interact with ACTG1 and non-muscle myosin II. Interacts with HACD2 (PubMed:15024066).4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

View the complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		115437, 86 interactors

Protein interaction database and analysis system

More...IntActi		P51572, 44 interactors

Molecular INTeraction database

More...MINTi		P51572

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000392330

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1246
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...PDBei

Protein Data Bank RCSB

More...RCSB PDBi

Protein Data Bank Japan

More...PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4JZLX-ray2.20A/B/C/D168-233[»]
4JZPX-ray2.10A/B168-233[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...ProteinModelPortali		P51572

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		P51572

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili165 – 2371 PublicationAdd BLAST73

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi243 – 246Di-lysine motif4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the BCAP29/BCAP31 family.Curated

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1962 Eukaryota
COG5374 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000011863

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000204790

The HOVERGEN Database of Homologous Vertebrate Genes

More...HOVERGENi		HBG050661

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		P51572

KEGG Orthology (KO)

More...KOi		K14009

Identification of Orthologs from Complete Genome Data

More...OMAi		MQHSMRL

Database of Orthologous Groups

More...OrthoDBi		1514108at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		P51572

TreeFam database of animal gene trees

More...TreeFami		TF315310

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR008417 BAP29/BAP31
IPR040463 BAP29/BAP31_N

The PANTHER Classification System

More...PANTHERi		PTHR12701 PTHR12701, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF05529 Bap31, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: P51572-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSLQWTAVAT FLYAEVFVVL LLCIPFISPK RWQKIFKSRL VELLVSYGNT 
        60         70         80         90        100
FFVVLIVILV LLVIDAVREI RKYDDVTEKV NLQNNPGAME HFHMKLFRAQ 
       110        120        130        140        150
RNLYIAGFSL LLSFLLRRLV TLISQQATLL ASNEAFKKQA ESASEAAKKY 
       160        170        180        190        200
MEENDQLKKG AAVDGGKLDV GNAEVKLEEE NRSLKADLQK LKDELASTKQ 
       210        220        230        240 
KLEKAENQVL AMRKQSEGLT KEYDRLLEEH AKLQAAVDGP MDKKEE
Length:246
Mass (Da):27,992
Last modified:January 23, 2007 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD34367F870D6EB00
GO
Isoform 2 (identifier: P51572-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGAEASSSWCPGTALPEERLSVKRASEISGFLGQGSSGEAALDVLTHVLEGAGNKLTSSCGKPSSNRM

Note: No experimental confirmation available.
Show »
Length:313
Mass (Da):34,752
Checksum:iA92BFA18452A46A7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9JQ75C9JQ75_HUMAN
B-cell receptor-associated protein ...
BCAP31
187Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JMD7C9JMD7_HUMAN
B-cell receptor-associated protein ...
BCAP31
178Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J0M4C9J0M4_HUMAN
B-cell receptor-associated protein ...
BCAP31
188Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JSP1C9JSP1_HUMAN
B-cell receptor-associated protein ...
BCAP31
182Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A2R8Y5M6A0A2R8Y5M6_HUMAN
B-cell receptor-associated protein ...
BCAP31
211Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JM14C9JM14_HUMAN
B-cell receptor-associated protein ...
BCAP31
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti2S → T in CAA57415 (PubMed:8612576).Curated1
Sequence conflicti72K → E in AAH14323 (PubMed:15489334).Curated1
Sequence conflicti208Q → E in CAA57415 (PubMed:8612576).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0431161M → MGAEASSSWCPGTALPEERL SVKRASEISGFLGQGSSGEA ALDVLTHVLEGAGNKLTSSC GKPSSNRM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
Z31696 mRNA Translation: CAA83501.1
X81109 mRNA Translation: CAA57015.1
X81817 mRNA Translation: CAA57415.1
AK057613 mRNA Translation: BAG51941.1
AK125631 mRNA Translation: BAG54226.1
U52111 Genomic DNA No translation available.
CH471172 Genomic DNA Translation: EAW72818.1
CH471172 Genomic DNA Translation: EAW72819.1
CH471172 Genomic DNA Translation: EAW72820.1
CH471172 Genomic DNA Translation: EAW72821.1
CH471172 Genomic DNA Translation: EAW72823.1
CH471172 Genomic DNA Translation: EAW72824.1
CH471172 Genomic DNA Translation: EAW72825.1
BC014323 mRNA Translation: AAH14323.1
BC065292 mRNA Translation: AAH65292.1
U36341 Genomic DNA Translation: AAA79508.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS14727.1 [P51572-1]
CCDS48191.1 [P51572-2]

Protein sequence database of the Protein Information Resource

More...PIRi		S44279

NCBI Reference Sequences

More...RefSeqi		NP_001132913.1, NM_001139441.1 [P51572-1]
NP_001132929.1, NM_001139457.2 [P51572-2]
NP_001243376.1, NM_001256447.1 [P51572-1]
NP_005736.3, NM_005745.7 [P51572-1]

UniGene gene-oriented nucleotide sequence clusters

More...UniGenei		Hs.522817

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000345046; ENSP00000343458; ENSG00000185825 [P51572-1]
ENST00000458587; ENSP00000392330; ENSG00000185825 [P51572-2]
ENST00000647529; ENSP00000494052; ENSG00000185825 [P51572-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		10134

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:10134

UCSC genome browser

More...UCSCi		uc004fid.4 human [P51572-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
Z31696 mRNA Translation: CAA83501.1
X81109 mRNA Translation: CAA57015.1
X81817 mRNA Translation: CAA57415.1
AK057613 mRNA Translation: BAG51941.1
AK125631 mRNA Translation: BAG54226.1
U52111 Genomic DNA No translation available.
CH471172 Genomic DNA Translation: EAW72818.1
CH471172 Genomic DNA Translation: EAW72819.1
CH471172 Genomic DNA Translation: EAW72820.1
CH471172 Genomic DNA Translation: EAW72821.1
CH471172 Genomic DNA Translation: EAW72823.1
CH471172 Genomic DNA Translation: EAW72824.1
CH471172 Genomic DNA Translation: EAW72825.1
BC014323 mRNA Translation: AAH14323.1
BC065292 mRNA Translation: AAH65292.1
U36341 Genomic DNA Translation: AAA79508.1
CCDSiCCDS14727.1 [P51572-1]
CCDS48191.1 [P51572-2]
PIRiS44279
RefSeqiNP_001132913.1, NM_001139441.1 [P51572-1]
NP_001132929.1, NM_001139457.2 [P51572-2]
NP_001243376.1, NM_001256447.1 [P51572-1]
NP_005736.3, NM_005745.7 [P51572-1]
UniGeneiHs.522817

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4JZLX-ray2.20A/B/C/D168-233[»]
4JZPX-ray2.10A/B168-233[»]
ProteinModelPortaliP51572
SMRiP51572
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115437, 86 interactors
IntActiP51572, 44 interactors
MINTiP51572
STRINGi9606.ENSP00000392330

Protein family/group databases

TCDBi3.A.5.9.1 the general secretory pathway (sec) family

PTM databases

iPTMnetiP51572
PhosphoSitePlusiP51572
SwissPalmiP51572

Polymorphism and mutation databases

BioMutaiBCAP31
DMDMi1705725

Proteomic databases

EPDiP51572
jPOSTiP51572
MaxQBiP51572
PaxDbiP51572
PeptideAtlasiP51572
PRIDEiP51572
ProteomicsDBi56335
56336 [P51572-2]
TopDownProteomicsiP51572-1 [P51572-1]
P51572-2 [P51572-2]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		10134
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000345046; ENSP00000343458; ENSG00000185825 [P51572-1]
ENST00000458587; ENSP00000392330; ENSG00000185825 [P51572-2]
ENST00000647529; ENSP00000494052; ENSG00000185825 [P51572-1]
GeneIDi10134
KEGGihsa:10134
UCSCiuc004fid.4 human [P51572-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		10134
DisGeNETi10134
EuPathDBiHostDB:ENSG00000185825.15

GeneCards: human genes, protein and diseases

More...GeneCardsi		BCAP31
HGNCiHGNC:16695 BCAP31
HPAiCAB015350
CAB015424
HPA003906
MalaCardsiBCAP31
MIMi300398 gene
300475 phenotype
neXtProtiNX_P51572
OpenTargetsiENSG00000185825
Orphaneti369942 CADDS
369939 Severe motor and intellectual disabilities-sensorineural deafness-dystonia syndrome
PharmGKBiPA128394569

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1962 Eukaryota
COG5374 LUCA
GeneTreeiENSGT00390000011863
HOGENOMiHOG000204790
HOVERGENiHBG050661
InParanoidiP51572
KOiK14009
OMAiMQHSMRL
OrthoDBi1514108at2759
PhylomeDBiP51572
TreeFamiTF315310

Enzyme and pathway databases

ReactomeiR-HSA-111465 Apoptotic cleavage of cellular proteins
R-HSA-75153 Apoptotic execution phase
R-HSA-983170 Antigen Presentation: Folding, assembly and peptide loading of class I MHC

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		BCAP31 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		BCAP31

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		10134
PMAP-CutDBiP51572

Protein Ontology

More...PROi		PR:P51572

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000185825 Expressed in 230 organ(s), highest expression level in subcutaneous adipose tissue
CleanExiHS_BCAP31
ExpressionAtlasiP51572 baseline and differential
GenevisibleiP51572 HS

Family and domain databases

InterProiView protein in InterPro
IPR008417 BAP29/BAP31
IPR040463 BAP29/BAP31_N
PANTHERiPTHR12701 PTHR12701, 1 hit
PfamiView protein in Pfam
PF05529 Bap31, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiBAP31_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: P51572
Secondary accession number(s): B3KQ79
, D3DWV5, Q13836, Q96CF0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 1, 1996
Last sequence update: January 23, 2007
Last modified: January 16, 2019
This is version 182 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again