UniProtKB - P51513 (NOVA1_HUMAN)
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>sp|P51513|NOVA1_HUMAN RNA-binding protein Nova-1 OS=Homo sapiens OX=9606 GN=NOVA1 PE=1 SV=1 MMAAAPIQQNGTHTGVPIDLDPPDSRKRPLEAPPEAGSTKRTNTGEDGQYFLKVLIPSYA AGSIIGKGGQTIVQLQKETGATIKLSKLSKSKDFYPGTTERVCLIQGTVEALNAVHGFIA EKIREMPQNVAKTEPVSILQPQTTVNPDRIKQTLPSSPTTTKSSPSDPMTTSRANQVKII VPNSTAGLIIGKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEPEQNRKAVELI IQKIQEDPQSGSCLNISYANVTGPVANSNPTGSPYANTAEVLPTAAAAAGLLGHANLAGV AAFPAVLSGFTGNDLVAITSALNTLASYGYNLNTLGLGLSQAAATGALAAAAASANPAAA AANLLATYASEASASGSTAGGTAGTFALGSLAAATAATNGYFGAASPLAASAILGTEKST DGSKDVVEIAVPENLVGAILGKGGKTLVEYQELTGARIQISKKGEFVPGTRNRKVTITGT PAATQAAQYLITQRITYEQGVRAANPQKVG
- Align
RNA-binding protein Nova-1
NOVA1
Annotation score:5 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni
- mRNA binding Source: Ensembl
- RNA binding Source: UniProtKBInferred from high throughput direct assayi
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi
- chemical synaptic transmission Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- locomotory behavior Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- mRNA splicing, via spliceosome Source: Ensembl
- regulation of RNA metabolic process Source: Ensembl
- RNA processing Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
- RNA splicing Source: ProtInc <p>Traceable Author Statement</p> <p>Used for information from review articles where the original experiments are traceable through that article and also for information from text books or dictionaries.</p> <p>More information in the <a href="http://geneontology.org/page/guide-go-evidence-codes#tas">GO evidence code guide</a></p> Traceable author statementi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi
| Molecular function | RNA-binding |
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Recommended name: RNA-binding protein Nova-1Alternative name(s): Neuro-oncological ventral antigen 1 Onconeural ventral antigen 1 Paraneoplastic Ri antigen Ventral neuron-specific protein 1 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:NOVA1 |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Homo sapiens (Human) |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 9606 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | cellular organisms › Eukaryota › Opisthokonta › Metazoa › Eumetazoa › Bilateria › Deuterostomia › Chordata › Craniata › Vertebrata › Gnathostomata › Teleostomi › Euteleostomi › Sarcopterygii › Dipnotetrapodomorpha › Tetrapoda › Amniota › Mammalia › Theria › Eutheria › Boreoeutheria › Euarchontoglires › Primates › Haplorrhini › Simiiformes › Catarrhini › Hominoidea › Hominidae › Homininae › Homo |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
Organism-specific databases
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000139910.19 |
Human Gene Nomenclature Database More...HGNCi | HGNC:7886 NOVA1 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 602157 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P51513 |
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Nucleus
Nucleus
Other locations
- intracellular membrane-bounded organelle Source: HPA
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Nucleus<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi
Organism-specific databases
DisGeNET More...DisGeNETi | 4857 |
Open Targets More...OpenTargetsi | ENSG00000139910 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA31688 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | NOVA1 |
Domain mapping of disease mutations (DMDM) More...DMDMi | 1709303 |
<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi
Molecule processing
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_0000050116 | 1 – 510 | RNA-binding protein Nova-1Add BLAST | 510 |
Amino acid modifications
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei | 157 | PhosphoserineBy similarity <p>Manually curated information which has been propagated from a related experimentally characterized protein.</p> <p><a href="/manual/evidences#ECO:0000250">More...</a></p> Manual assertion inferred from sequence similarity toi | 1 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - PTMi
PhosphoproteinProteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P51513 |
MaxQB - The MaxQuant DataBase More...MaxQBi | P51513 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P51513 |
PeptideAtlas More...PeptideAtlasi | P51513 |
PRoteomics IDEntifications database More...PRIDEi | P51513 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 56315 56316 [P51513-2] 56317 [P51513-3] 56318 [P51513-4] |
Consortium for Top Down Proteomics More...TopDownProteomicsi | P51513-2 [P51513-2] |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P51513 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P51513 |
<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni
<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000139910 |
CleanEx database of gene expression profiles More...CleanExi | HS_NOVA1 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P51513 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P51513 HS |
Organism-specific databases
Human Protein Atlas More...HPAi | HPA004155 |
<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni
<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 110919, 10 interactors |
Protein interaction database and analysis system More...IntActi | P51513, 8 interactors |
Molecular INTeraction database More...MINTi | P51513 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000438875 |
<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei
Secondary structure
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 50 – 57 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 58 – 65 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 67 – 69 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 70 – 79 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 10 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 82 – 85 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 98 – 107 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 10 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 109 – 123 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 15 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 148 – 151 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 177 – 182 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 6 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 183 – 190 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 192 – 194 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 195 – 203 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 9 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 207 – 210 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 221 – 229 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 9 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 230 – 245 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 16 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 425 – 432 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined hydrogen-bonded turns within the protein sequence. These elements correspond to the DSSP secondary structure code ‘T’.<p><a href='/help/turn' target='_top'>More...</a></p>Turni | 433 – 436 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 437 – 440 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 442 – 444 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 3 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 445 – 454 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 10 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 457 – 460 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 4 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined beta strands within the protein sequence.<p><a href='/help/strand' target='_top'>More...</a></p>Beta strandi | 472 – 479 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 8 | |
| <p>This subsection of the ‘Structure’ section is used to indicate the positions of experimentally determined helical regions within the protein sequence.<p><a href='/help/helix' target='_top'>More...</a></p>Helixi | 481 – 494 | Combined sources <p>Manually validated information inferred from a combination of experimental and computational evidence.</p> <p><a href="/manual/evidences#ECO:0000244">More...</a></p> Manual assertion inferred from combination of experimental and computational evidencei | 14 |
3D structure databases
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P51513 |
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P51513 |
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Miscellaneous databases
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P51513 |
<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
Domains and Repeats
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini | 49 – 119 | KH 1PROSITE-ProRule annotation <p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi Add BLAST | 71 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini | 174 – 240 | KH 2PROSITE-ProRule annotation <p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi Add BLAST | 67 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini | 424 – 491 | KH 3PROSITE-ProRule annotation <p>Manual validated information which has been generated by the UniProtKB automatic annotation system.</p> <p><a href="/manual/evidences#ECO:0000255">More...</a></p> Manual assertion according to rulesi Add BLAST | 68 |
Motif
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi | 27 – 43 | Bipartite nuclear localization signalSequence analysisAdd BLAST | 17 |
Compositional bias
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi | 276 – 412 | Ala-richAdd BLAST | 137 |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini
RepeatPhylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG2191 Eukaryota ENOG410XRZD LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00760000119144 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000007833 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG082048 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P51513 |
KEGG Orthology (KO) More...KOi | K14944 |
Identification of Orthologs from Complete Genome Data More...OMAi | VVDFIMD |
Database of Orthologous Groups More...OrthoDBi | EOG091G185U |
Database for complete collections of gene phylogenies More...PhylomeDBi | P51513 |
TreeFam database of animal gene trees More...TreeFami | TF316981 |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 3.30.1370.10, 3 hits |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR004087 KH_dom IPR004088 KH_dom_type_1 IPR036612 KH_dom_type_1_sf IPR033086 NOVA1 |
The PANTHER Classification System More...PANTHERi | PTHR10288:SF223 PTHR10288:SF223, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00013 KH_1, 3 hits |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00322 KH, 3 hits |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF54791 SSF54791, 3 hits |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS50084 KH_TYPE_1, 3 hits |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5)i
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basketAdded to basket
This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
10 20 30 40 50
MMAAAPIQQN GTHTGVPIDL DPPDSRKRPL EAPPEAGSTK RTNTGEDGQY
60 70 80 90 100
FLKVLIPSYA AGSIIGKGGQ TIVQLQKETG ATIKLSKLSK SKDFYPGTTE
110 120 130 140 150
RVCLIQGTVE ALNAVHGFIA EKIREMPQNV AKTEPVSILQ PQTTVNPDRI
160 170 180 190 200
KQTLPSSPTT TKSSPSDPMT TSRANQVKII VPNSTAGLII GKGGATVKAV
210 220 230 240 250
MEQSGAWVQL SQKPDGINLQ ERVVTVSGEP EQNRKAVELI IQKIQEDPQS
260 270 280 290 300
GSCLNISYAN VTGPVANSNP TGSPYANTAE VLPTAAAAAG LLGHANLAGV
310 320 330 340 350
AAFPAVLSGF TGNDLVAITS ALNTLASYGY NLNTLGLGLS QAAATGALAA
360 370 380 390 400
AAASANPAAA AANLLATYAS EASASGSTAG GTAGTFALGS LAAATAATNG
410 420 430 440 450
YFGAASPLAA SAILGTEKST DGSKDVVEIA VPENLVGAIL GKGGKTLVEY
460 470 480 490 500
QELTGARIQI SKKGEFVPGT RNRKVTITGT PAATQAAQYL ITQRITYEQG
510
VRAANPQKVG
The sequence of this isoform differs from the canonical sequence as follows:
88-90: Missing.
177-184: VKIIVPNS → KHNISWIS
185-510: Missing.
10 20 30 40 50
MMAAAPIQQN GTHTGVPIDL DPPDSRKRPL EAPPEAGSTK RTNTGEDGQY
60 70 80 90 100
FLKVLIPSYA AGSIIGKGGQ TIVQLQKETG ATIKLSKSKD FYPGTTERVC
110 120 130 140 150
LIQGTVEALN AVHGFIAEKI REMPQNVAKT EPVSILQPQT TVNPDRIKQT
160 170 180
LPSSPTTTKS SPSDPMTTSR ANQKHNISWI S
The sequence of this isoform differs from the canonical sequence as follows:
153-176: Missing.
10 20 30 40 50
MMAAAPIQQN GTHTGVPIDL DPPDSRKRPL EAPPEAGSTK RTNTGEDGQY
60 70 80 90 100
FLKVLIPSYA AGSIIGKGGQ TIVQLQKETG ATIKLSKLSK SKDFYPGTTE
110 120 130 140 150
RVCLIQGTVE ALNAVHGFIA EKIREMPQNV AKTEPVSILQ PQTTVNPDRI
160 170 180 190 200
KQVKIIVPNS TAGLIIGKGG ATVKAVMEQS GAWVQLSQKP DGINLQERVV
210 220 230 240 250
TVSGEPEQNR KAVELIIQKI QEDPQSGSCL NISYANVTGP VANSNPTGSP
260 270 280 290 300
YANTAEVLPT AAAAAGLLGH ANLAGVAAFP AVLSGFTGND LVAITSALNT
310 320 330 340 350
LASYGYNLNT LGLGLSQAAA TGALAAAAAS ANPAAAAANL LATYASEASA
360 370 380 390 400
SGSTAGGTAG TFALGSLAAA TAATNGYFGA ASPLAASAIL GTEKSTDGSK
410 420 430 440 450
DVVEIAVPEN LVGAILGKGG KTLVEYQELT GARIQISKKG EFVPGTRNRK
460 470 480
VTITGTPAAT QAAQYLITQR ITYEQGVRAA NPQKVG
The sequence of this isoform differs from the canonical sequence as follows:
88-90: Missing.
10 20 30 40 50
MMAAAPIQQN GTHTGVPIDL DPPDSRKRPL EAPPEAGSTK RTNTGEDGQY
60 70 80 90 100
FLKVLIPSYA AGSIIGKGGQ TIVQLQKETG ATIKLSKSKD FYPGTTERVC
110 120 130 140 150
LIQGTVEALN AVHGFIAEKI REMPQNVAKT EPVSILQPQT TVNPDRIKQT
160 170 180 190 200
LPSSPTTTKS SPSDPMTTSR ANQVKIIVPN STAGLIIGKG GATVKAVMEQ
210 220 230 240 250
SGAWVQLSQK PDGINLQERV VTVSGEPEQN RKAVELIIQK IQEDPQSGSC
260 270 280 290 300
LNISYANVTG PVANSNPTGS PYANTAEVLP TAAAAAGLLG HANLAGVAAF
310 320 330 340 350
PAVLSGFTGN DLVAITSALN TLASYGYNLN TLGLGLSQAA ATGALAAAAA
360 370 380 390 400
SANPAAAAAN LLATYASEAS ASGSTAGGTA GTFALGSLAA ATAATNGYFG
410 420 430 440 450
AASPLAASAI LGTEKSTDGS KDVVEIAVPE NLVGAILGKG GKTLVEYQEL
460 470 480 490 500
TGARIQISKK GEFVPGTRNR KVTITGTPAA TQAAQYLITQ RITYEQGVRA
ANPQKVG
The sequence of this isoform differs from the canonical sequence as follows:
88-90: Missing.
153-176: Missing.
10 20 30 40 50
MMAAAPIQQN GTHTGVPIDL DPPDSRKRPL EAPPEAGSTK RTNTGEDGQY
60 70 80 90 100
FLKVLIPSYA AGSIIGKGGQ TIVQLQKETG ATIKLSKSKD FYPGTTERVC
110 120 130 140 150
LIQGTVEALN AVHGFIAEKI REMPQNVAKT EPVSILQPQT TVNPDRIKQV
160 170 180 190 200
KIIVPNSTAG LIIGKGGATV KAVMEQSGAW VQLSQKPDGI NLQERVVTVS
210 220 230 240 250
GEPEQNRKAV ELIIQKIQED PQSGSCLNIS YANVTGPVAN SNPTGSPYAN
260 270 280 290 300
TAEVLPTAAA AAGLLGHANL AGVAAFPAVL SGFTGNDLVA ITSALNTLAS
310 320 330 340 350
YGYNLNTLGL GLSQAAATGA LAAAAASANP AAAAANLLAT YASEASASGS
360 370 380 390 400
TAGGTAGTFA LGSLAAATAA TNGYFGAASP LAASAILGTE KSTDGSKDVV
410 420 430 440 450
EIAVPENLVG AILGKGGKTL VEYQELTGAR IQISKKGEFV PGTRNRKVTI
460 470 480
TGTPAATQAA QYLITQRITY EQGVRAANPQ KVG
Alternative sequence
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_002841 | 88 – 90 | Missing in isoform 2, isoform 4 and isoform 5. 3 Publications <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 3 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_002842 | 153 – 176 | Missing in isoform 3 and isoform 5. 1 Publication <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 24 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_002843 | 177 – 184 | VKIIVPNS → KHNISWIS in isoform 2. 2 Publications <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 8 | |
| <p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_002844 | 185 – 510 | Missing in isoform 2. 2 Publications <p>Manually curated information that is based on statements in scientific articles for which there is no experimental support.</p> <p><a href="/manual/evidences#ECO:0000303">More...</a></p> Manual assertion based on opinion ini
| 326 |
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | U04840 mRNA Translation: AAA16022.1 AK289639 mRNA Translation: BAF82328.1 AK291022 mRNA Translation: BAF83711.1 AL079343 Genomic DNA No translation available. AL132716 Genomic DNA No translation available. CH471078 Genomic DNA Translation: EAW65990.1 CH471078 Genomic DNA Translation: EAW65991.1 CH471078 Genomic DNA Translation: EAW65992.1 CH471078 Genomic DNA Translation: EAW65993.1 CH471078 Genomic DNA Translation: EAW65995.1 BC075038 mRNA Translation: AAH75038.1 BC075039 mRNA Translation: AAH75039.1 Z70771 mRNA Translation: CAA94810.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS32060.1 [P51513-5] CCDS32061.1 [P51513-4] CCDS9635.1 [P51513-2] |
Protein sequence database of the Protein Information Resource More...PIRi | I38489 |
NCBI Reference Sequences More...RefSeqi | NP_002506.2, NM_002515.2 [P51513-4] NP_006480.2, NM_006489.2 [P51513-5] NP_006482.1, NM_006491.2 [P51513-2] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.31588 |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000344429; ENSP00000342387; ENSG00000139910 [P51513-2] ENST00000465357; ENSP00000447391; ENSG00000139910 [P51513-5] ENST00000539517; ENSP00000438875; ENSG00000139910 [P51513-4] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 4857 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:4857 |
UCSC genome browser More...UCSCi | uc001wpy.4 human [P51513-1] |
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi
Alternative splicing<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P51513 | cDNA FLJ54517, highly similar to RNA-binding protein Nova-1 | 385 | |||
| RNA-binding protein Nova-1 (Fragment) | 96 | ||||
| P51513-2 | NOVA1 isoform 6 | 193 | |||
| NOVA alternative splicing regulator 1 | 181 | ||||
| NOVA alternative splicing regulator 1 | 181 | ||||
| NOVA alternative splicing regulator 1 | 181 | ||||
| NOVA alternative splicing regulator 1 | 181 | ||||
| +5 | |||||
| P51513-3 | UPI0000EE4971 | 361 | |||
| RNA-binding protein Nova-1 (Fragment) | 109 | ||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P51513 | cDNA FLJ54517, highly similar to RNA-binding protein Nova-1 | 385 | |||
| UPI00038341DC | 599 | ||||
| UPI000511165D | 535 | ||||
| UPI0004F484BA | 521 | ||||
| UPI0004C0C911 | 513 | ||||
| +80 | |||||
| P51513-2 | RNA-binding protein Nova-1 | 211 | |||
| NOVA1 isoform 3 | 211 | ||||
| NOVA1 isoform 10 | 211 | ||||
| NOVA alternative splicing regulator 1 | 199 | ||||
| RNA-binding protein Nova-1 (Fragment) | 105 | ||||
| +26 | |||||
| P51513-3 | UPI0000EE4971 | 361 | |||
| MGC84002 protein | 484 | ||||
| UPI000069E251 | 484 | ||||
| UPI0003C1B2EA | 484 | ||||
| UPI0004573B0E | 484 | ||||
| +61 | |||||
| P51513-5 | UPI0000EE4971 | 361 | |||
| MGC84002 protein | 484 | ||||
| UPI000069E251 | 484 | ||||
| UPI0003C1B2EA | 484 | ||||
| UPI0004573B0E | 484 | ||||
| +61 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| P51513 | cDNA FLJ54517, highly similar to RNA-binding protein Nova-1 | 385 | |||
| UPI00038341DC | 599 | ||||
| UPI000511165D | 535 | ||||
| UPI0004F484BA | 521 | ||||
| UPI0004C0C911 | 513 | ||||
| +109 | |||||
| P51513-2 | RNA-binding protein Nova-1 | 211 | |||
| NOVA1 isoform 3 | 211 | ||||
| NOVA1 isoform 10 | 211 | ||||
| NOVA alternative splicing regulator 1 | 199 | ||||
| RNA-binding protein Nova-1 (Fragment) | 105 | ||||
| +26 | |||||
| P51513-3 | UPI0000EE4971 | 361 | |||
| UPI0004573B0E | 484 | ||||
| MGC84002 protein | 484 | ||||
| UPI000069E251 | 484 | ||||
| UPI0003C1B2EA | 484 | ||||
| +185 | |||||
| P51513-5 | UPI0000EE4971 | 361 | |||
| UPI0004573B0E | 484 | ||||
| MGC84002 protein | 484 | ||||
| UPI000069E251 | 484 | ||||
| UPI0003C1B2EA | 484 | ||||
| +185 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | U04840 mRNA Translation: AAA16022.1 AK289639 mRNA Translation: BAF82328.1 AK291022 mRNA Translation: BAF83711.1 AL079343 Genomic DNA No translation available. AL132716 Genomic DNA No translation available. CH471078 Genomic DNA Translation: EAW65990.1 CH471078 Genomic DNA Translation: EAW65991.1 CH471078 Genomic DNA Translation: EAW65992.1 CH471078 Genomic DNA Translation: EAW65993.1 CH471078 Genomic DNA Translation: EAW65995.1 BC075038 mRNA Translation: AAH75038.1 BC075039 mRNA Translation: AAH75039.1 Z70771 mRNA Translation: CAA94810.1 |
The Consensus CDS (CCDS) project More...CCDSi | CCDS32060.1 [P51513-5] CCDS32061.1 [P51513-4] CCDS9635.1 [P51513-2] |
Protein sequence database of the Protein Information Resource More...PIRi | I38489 |
NCBI Reference Sequences More...RefSeqi | NP_002506.2, NM_002515.2 [P51513-4] NP_006480.2, NM_006489.2 [P51513-5] NP_006482.1, NM_006491.2 [P51513-2] |
UniGene gene-oriented nucleotide sequence clusters More...UniGenei | Hs.31588 |
3D structure databases
| Select the link destinations: Protein Data Bank Europe More...PDBeiProtein Data Bank RCSB More...RCSB PDBiProtein Data Bank Japan More...PDBjiLinks Updated | PDB entry | Method | Resolution (Å) | Chain | Positions | PDBsum |
| 1DT4 | X-ray | 2.60 | A | 424-495 | [»] | |
| 2ANN | X-ray | 2.30 | A | 49-249 | [»] | |
| 2ANR | X-ray | 1.94 | A | 49-249 | [»] | |
Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase More...ProteinModelPortali | P51513 | |||||
SWISS-MODEL Repository - a database of annotated 3D protein structure models More...SMRi | P51513 | |||||
Database of comparative protein structure models More...ModBasei | Search... | |||||
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... | |||||
Protein-protein interaction databases
The Biological General Repository for Interaction Datasets (BioGrid) More...BioGridi | 110919, 10 interactors |
Protein interaction database and analysis system More...IntActi | P51513, 8 interactors |
Molecular INTeraction database More...MINTi | P51513 |
STRING: functional protein association networks More...STRINGi | 9606.ENSP00000438875 |
PTM databases
iPTMnet integrated resource for PTMs in systems biology context More...iPTMneti | P51513 |
Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat. More...PhosphoSitePlusi | P51513 |
Polymorphism and mutation databases
BioMuta curated single-nucleotide variation and disease association database More...BioMutai | NOVA1 |
Domain mapping of disease mutations (DMDM) More...DMDMi | 1709303 |
Proteomic databases
Encyclopedia of Proteome Dynamics More...EPDi | P51513 |
MaxQB - The MaxQuant DataBase More...MaxQBi | P51513 |
PaxDb, a database of protein abundance averages across all three domains of life More...PaxDbi | P51513 |
PeptideAtlas More...PeptideAtlasi | P51513 |
PRoteomics IDEntifications database More...PRIDEi | P51513 |
ProteomicsDB human proteome resource More...ProteomicsDBi | 56315 56316 [P51513-2] 56317 [P51513-3] 56318 [P51513-4] |
Consortium for Top Down Proteomics More...TopDownProteomicsi | P51513-2 [P51513-2] |
Protocols and materials databases
| Structural Biology Knowledgebase | Search... |
Genome annotation databases
Ensembl eukaryotic genome annotation project More...Ensembli | ENST00000344429; ENSP00000342387; ENSG00000139910 [P51513-2] ENST00000465357; ENSP00000447391; ENSG00000139910 [P51513-5] ENST00000539517; ENSP00000438875; ENSG00000139910 [P51513-4] |
Database of genes from NCBI RefSeq genomes More...GeneIDi | 4857 |
KEGG: Kyoto Encyclopedia of Genes and Genomes More...KEGGi | hsa:4857 |
UCSC genome browser More...UCSCi | uc001wpy.4 human [P51513-1] |
Organism-specific databases
Comparative Toxicogenomics Database More...CTDi | 4857 |
DisGeNET More...DisGeNETi | 4857 |
Eukaryotic Pathogen Database Resources More...EuPathDBi | HostDB:ENSG00000139910.19 |
GeneCards: human genes, protein and diseases More...GeneCardsi | NOVA1 |
H-Invitational Database, human transcriptome db More...H-InvDBi | HIX0037755 |
Human Gene Nomenclature Database More...HGNCi | HGNC:7886 NOVA1 |
Human Protein Atlas More...HPAi | HPA004155 |
Online Mendelian Inheritance in Man (OMIM) More...MIMi | 602157 gene |
neXtProt; the human protein knowledge platform More...neXtProti | NX_P51513 |
Open Targets More...OpenTargetsi | ENSG00000139910 |
The Pharmacogenetics and Pharmacogenomics Knowledge Base More...PharmGKBi | PA31688 |
GenAtlas: human gene database More...GenAtlasi | Search... |
Phylogenomic databases
evolutionary genealogy of genes: Non-supervised Orthologous Groups More...eggNOGi | KOG2191 Eukaryota ENOG410XRZD LUCA |
Ensembl GeneTree More...GeneTreei | ENSGT00760000119144 |
The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms More...HOGENOMi | HOG000007833 |
The HOVERGEN Database of Homologous Vertebrate Genes More...HOVERGENi | HBG082048 |
InParanoid: Eukaryotic Ortholog Groups More...InParanoidi | P51513 |
KEGG Orthology (KO) More...KOi | K14944 |
Identification of Orthologs from Complete Genome Data More...OMAi | VVDFIMD |
Database of Orthologous Groups More...OrthoDBi | EOG091G185U |
Database for complete collections of gene phylogenies More...PhylomeDBi | P51513 |
TreeFam database of animal gene trees More...TreeFami | TF316981 |
Miscellaneous databases
ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data More...ChiTaRSi | NOVA1 human |
Relative evolutionary importance of amino acids within a protein sequence More...EvolutionaryTracei | P51513 |
The Gene Wiki collection of pages on human genes and proteins More...GeneWikii | NOVA1 |
Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens More...GenomeRNAii | 4857 |
Protein Ontology More...PROi | PR:P51513 |
The Stanford Online Universal Resource for Clones and ESTs More...SOURCEi | Search... |
Gene expression databases
Bgee dataBase for Gene Expression Evolution More...Bgeei | ENSG00000139910 |
CleanEx database of gene expression profiles More...CleanExi | HS_NOVA1 |
ExpressionAtlas, Differential and Baseline Expression More...ExpressionAtlasi | P51513 baseline and differential |
Genevisible search portal to normalized and curated expression data from Genevestigator More...Genevisiblei | P51513 HS |
Family and domain databases
Gene3D Structural and Functional Annotation of Protein Families More...Gene3Di | 3.30.1370.10, 3 hits |
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR004087 KH_dom IPR004088 KH_dom_type_1 IPR036612 KH_dom_type_1_sf IPR033086 NOVA1 |
The PANTHER Classification System More...PANTHERi | PTHR10288:SF223 PTHR10288:SF223, 1 hit |
Pfam protein domain database More...Pfami | View protein in Pfam PF00013 KH_1, 3 hits |
Simple Modular Architecture Research Tool; a protein domain database More...SMARTi | View protein in SMART SM00322 KH, 3 hits |
Superfamily database of structural and functional annotation More...SUPFAMi | SSF54791 SSF54791, 3 hits |
PROSITE; a protein domain and family database More...PROSITEi | View protein in PROSITE PS50084 KH_TYPE_1, 3 hits |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | NOVA1_HUMAN | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | P51513Primary (citable) accession number: P51513 Secondary accession number(s): A8K0S4 , A8K4Q7, D3DS81, D3DS82, Q6B004 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/Swiss-Prot: | October 1, 1996 |
| Last sequence update: | October 1, 1996 | |
| Last modified: | June 20, 2018 | |
| This is version 156 of the entry and version 1 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
| Annotation program | Chordata Protein Annotation Program | |
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
3D-structure, Complete proteome, Reference proteomeDocuments
- Human chromosome 14
Human chromosome 14: entries, gene names and cross-references to MIM - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - PDB cross-references
Index of Protein Data Bank (PDB) cross-references
